(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE43

PENCW_10.PE43        Location/Qualifiers
FT   CDS             join(complement(106302..106418),complement(105856..106257))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948698"
FT                   /orf_name="Pc13g00430"
FT                   /product="Putative uncharacterized protein Pc13g00430 "
FT                   /protein_id="CAP91112.1"
FT                   /db_xref="UniParc:UPI0001830E91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H171"
FT                   /transl_table=1
FT                   /translation="MESPSKTSEGTGTQAEAPLYTQSSPTEEPPLPDVATPLPTLNHDI
FT                   ERQTLAVEPFRPILEVLKQIEEEDTELAFRAAHLVGYIRCLWESCVSKHTDIQQLEEEN
FT                   EKLRTGNIQLCNEGNRLKRYQDEQVSRLHAIDDALDEVRGRLIGVLKVWNDRSVGDLAI
FT                   LPEDGFPRC"
     MESPSKTSEG TGTQAEAPLY TQSSPTEEPP LPDVATPLPT LNHDIERQTL AVEPFRPILE        60
     VLKQIEEEDT ELAFRAAHLV GYIRCLWESC VSKHTDIQQL EEENEKLRTG NIQLCNEGNR       120
     LKRYQDEQVS RLHAIDDALD EVRGRLIGVL KVWNDRSVGD LAILPEDGFP RC               172
//

If you have problems or comments...

PBIL Back to PBIL home page