(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE430

PENCW_10.PE430       Location/Qualifiers
FT   CDS             1026552..1027613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950903"
FT                   /orf_name="Pc13g04300"
FT                   /product="Pc13g04300 protein"
FT                   /protein_id="CAP91499.1"
FT                   /db_xref="UniParc:UPI0001830AD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H285"
FT                   /transl_table=1
FT                   /translation="MAATSTPGNNEPHRILLVSVPRTASNLLLKVLNIPNQPNVLSSPK
FT                   GGYFFYDAFMAAGIEGLVEKPLDQWTAEEKSETKAVVQKCFDRLEEYSARARAENKIMF
FT                   TKEHAFWLVNPCFFTNNEGITPEDHSQFQVSMPERYGSSATFSAKNKTIMPDEYLRTWR
FT                   IAFIIRHPALAWPSMYRAMQKLSKAGFIDDDGMRGASFTNMSMEWTRTLFDWCREQPDE
FT                   SVTPLVIDANDVIHNPGAVVKFCEKAGLDTSFMQFEWNGAEKKSESWAAETANADTPEE
FT                   VAFHKTAASIMLSTLEESTGVVKDKAPASVDIDAEVAKWRLEFGDEVAELIEKATRDSM
FT                   PDYEYLKANRVTA"
     MAATSTPGNN EPHRILLVSV PRTASNLLLK VLNIPNQPNV LSSPKGGYFF YDAFMAAGIE        60
     GLVEKPLDQW TAEEKSETKA VVQKCFDRLE EYSARARAEN KIMFTKEHAF WLVNPCFFTN       120
     NEGITPEDHS QFQVSMPERY GSSATFSAKN KTIMPDEYLR TWRIAFIIRH PALAWPSMYR       180
     AMQKLSKAGF IDDDGMRGAS FTNMSMEWTR TLFDWCREQP DESVTPLVID ANDVIHNPGA       240
     VVKFCEKAGL DTSFMQFEWN GAEKKSESWA AETANADTPE EVAFHKTAAS IMLSTLEEST       300
     GVVKDKAPAS VDIDAEVAKW RLEFGDEVAE LIEKATRDSM PDYEYLKANR VTA              353
//

If you have problems or comments...

PBIL Back to PBIL home page