(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE431

PENCW_10.PE431       Location/Qualifiers
FT   CDS             join(complement(1029971..1030094),
FT                   complement(1029721..1029926),complement(1029503..1029652),
FT                   complement(1029424..1029443),complement(1029338..1029374),
FT                   complement(1027993..1029090))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672472"
FT                   /orf_name="Pc13g04310"
FT                   /product="Pc13g04310 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP91500.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001830AD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H286"
FT                   /transl_table=1
FT                   /translation="MSSEGGSGINKRAEKECSLTPLKILGLIENIKMSYSSQIMIWYRN
FT                   TYQDLSKDEILLNLDTPGVMEMLLCRGGQPDTISIELGVSYISFKLYIWSLVFPSFSVA
FT                   GIEKYPVELYTISSSTHCETSPGLGWLEPRRVGKHIKRLSRKSRQFMNSFISIRNMSAL
FT                   PRTRSLTSHSSILEAQANRLASSIAKTNASKKSVDLLYAFRSYTLDTIMCFTFGNCVNA
FT                   LDAPAFSDPLILAMDASLRMLPLMKNFPIIRDLIFAIPPSLVMRLILNSQKLAPRLYQV
FT                   RDLVQQQLQVVLNCPSKLDTVPHQTLFHRMLDPESYRSKQVLNMTELHDEGFTLIFAGA
FT                   NTVADTLLMGHWHLMQNQALLTQLRTEILTVWPDEKQPSLADLETLPLLTATIKESLRF
FT                   IPSGVSLTRVVPPGGAVIGGKQIPGGTVVGMAILHVHQSAEVWGADALVFRPERWLESA
FT                   EQANARNGKSELDHWLVAFSRGPRMCFGMNLAWAEMYIALATMIRHFDLTIDGTTAEDM
FT                   QWRECIAAYYPNRHLHAWCRPVGSGEV"
     MSSEGGSGIN KRAEKECSLT PLKILGLIEN IKMSYSSQIM IWYRNTYQDL SKDEILLNLD        60
     TPGVMEMLLC RGGQPDTISI ELGVSYISFK LYIWSLVFPS FSVAGIEKYP VELYTISSST       120
     HCETSPGLGW LEPRRVGKHI KRLSRKSRQF MNSFISIRNM SALPRTRSLT SHSSILEAQA       180
     NRLASSIAKT NASKKSVDLL YAFRSYTLDT IMCFTFGNCV NALDAPAFSD PLILAMDASL       240
     RMLPLMKNFP IIRDLIFAIP PSLVMRLILN SQKLAPRLYQ VRDLVQQQLQ VVLNCPSKLD       300
     TVPHQTLFHR MLDPESYRSK QVLNMTELHD EGFTLIFAGA NTVADTLLMG HWHLMQNQAL       360
     LTQLRTEILT VWPDEKQPSL ADLETLPLLT ATIKESLRFI PSGVSLTRVV PPGGAVIGGK       420
     QIPGGTVVGM AILHVHQSAE VWGADALVFR PERWLESAEQ ANARNGKSEL DHWLVAFSRG       480
     PRMCFGMNLA WAEMYIALAT MIRHFDLTID GTTAEDMQWR ECIAAYYPNR HLHAWCRPVG       540
     SGEV                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page