(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE432

PENCW_10.PE432       Location/Qualifiers
FT   CDS             join(complement(1033206..1033300),
FT                   complement(1033058..1033153),complement(1031838..1032981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825167"
FT                   /orf_name="Pc13g04320"
FT                   /product="Pc13g04320 protein"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="CAP91501.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniParc:UPI0001830AD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H288"
FT                   /transl_table=1
FT                   /translation="MDLSKTLIRTVARAFYETRHILVVDALFLHSVLHAEDLAFLMGMQ
FT                   QKDLRKLCAKLREDRLIGVSTRAEIRDGSTRPVNREYYYIPLHPVVDAIKYKVSKLTAI
FT                   IKAQYTPSEERKEYICLRCKSEWTELDVLSLVSEEGFECQNCSAILERTEDVKGAEGMD
FT                   STGHEKNSKLMAQLDNMLKLLKQIDAVEIPPNDFETAWDHKVEVARNQHTHPVRAAIAV
FT                   PPKPQDITRPNAKTDAAALEISLTSSEEKSAAEQADEAARKAALEKQNALPVWHTHSTV
FT                   NTTQVGSQIKTDVGTVVKPELADEDQKPSVDALDDKVAAYYAEMEREKELQAQADASSA
FT                   DEDSDEEDFEDVEGISGPSGPATPAIAAPATSSGAAGIKREHEATSSGPPSSTGTPSTP
FT                   ADDGPVAKKIKVEPDIKPDPDAKIEAEVKKEAEESDEDDEEFEDV"
     MDLSKTLIRT VARAFYETRH ILVVDALFLH SVLHAEDLAF LMGMQQKDLR KLCAKLREDR        60
     LIGVSTRAEI RDGSTRPVNR EYYYIPLHPV VDAIKYKVSK LTAIIKAQYT PSEERKEYIC       120
     LRCKSEWTEL DVLSLVSEEG FECQNCSAIL ERTEDVKGAE GMDSTGHEKN SKLMAQLDNM       180
     LKLLKQIDAV EIPPNDFETA WDHKVEVARN QHTHPVRAAI AVPPKPQDIT RPNAKTDAAA       240
     LEISLTSSEE KSAAEQADEA ARKAALEKQN ALPVWHTHST VNTTQVGSQI KTDVGTVVKP       300
     ELADEDQKPS VDALDDKVAA YYAEMEREKE LQAQADASSA DEDSDEEDFE DVEGISGPSG       360
     PATPAIAAPA TSSGAAGIKR EHEATSSGPP SSTGTPSTPA DDGPVAKKIK VEPDIKPDPD       420
     AKIEAEVKKE AEESDEDDEE FEDV                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page