(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE433

PENCW_10.PE433       Location/Qualifiers
FT   CDS             join(<1033861..1033958,1034015..1034218,1034276..1034730,
FT                   1034851..1035502,1035567..1035804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672473"
FT                   /orf_name="Pc13g04330"
FT                   /product="Pc13g04330 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP91502.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001830AD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H289"
FT                   /transl_table=1
FT                   /translation="RDLPTDTMADNKGTGGGGGGRRKNRDMGRAEWSRQAIDKRQRHEE
FT                   KAEVKRRKIENGEEVKLPIYATQFSKEEIDSEERRPKKKVALLMGYSGTGYSGMQLNEQ
FT                   QRTIEGDLFTALVNVGAVSKANAADPKKSSFVRCARTDKGVHAAGNVVSLKMIVEDEDI
FT                   IQKINAELSPQIRVWGYEVTSKSFSCYQMCDSRVYEYLMPSHCLVPPHPSTYLGKKIVE
FT                   LADKAGELDAVKTRQEEVASYWEEVDEKYITEEPAQQETSEQPVAEQSADAEAQKPFVM
FT                   DPRQKAINDAIKSIKAAYLTAKRAYRAPASRIARLQECLNRYEGTKNFHNYTIQKTHKD
FT                   PSAKRHIKSFKVNTTPIIINGTEWLSLKVHGQSFMMHQIRKMVAMATMVVRSGCHPDRI
FT                   TETYGPERIAIPKAPGLGLLLERPIFDAYNNKAQGLDRQPINFQKFEAEMNEFKQREIY
FT                   DRIFREEEESAGFGSFFNHIDHFPAGYFLYVTSGGIPAAKLATAPTPAGPGSPKAGNKT
FT                   RGAPRQQDALAAVEVESEDEGDAPAGGEQEG"
     RDLPTDTMAD NKGTGGGGGG RRKNRDMGRA EWSRQAIDKR QRHEEKAEVK RRKIENGEEV        60
     KLPIYATQFS KEEIDSEERR PKKKVALLMG YSGTGYSGMQ LNEQQRTIEG DLFTALVNVG       120
     AVSKANAADP KKSSFVRCAR TDKGVHAAGN VVSLKMIVED EDIIQKINAE LSPQIRVWGY       180
     EVTSKSFSCY QMCDSRVYEY LMPSHCLVPP HPSTYLGKKI VELADKAGEL DAVKTRQEEV       240
     ASYWEEVDEK YITEEPAQQE TSEQPVAEQS ADAEAQKPFV MDPRQKAIND AIKSIKAAYL       300
     TAKRAYRAPA SRIARLQECL NRYEGTKNFH NYTIQKTHKD PSAKRHIKSF KVNTTPIIIN       360
     GTEWLSLKVH GQSFMMHQIR KMVAMATMVV RSGCHPDRIT ETYGPERIAI PKAPGLGLLL       420
     ERPIFDAYNN KAQGLDRQPI NFQKFEAEMN EFKQREIYDR IFREEEESAG FGSFFNHIDH       480
     FPAGYFLYVT SGGIPAAKLA TAPTPAGPGS PKAGNKTRGA PRQQDALAAV EVESEDEGDA       540
     PAGGEQEG                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page