(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE435

PENCW_10.PE435       Location/Qualifiers
FT   CDS             join(complement(1045689..1045849),
FT                   complement(1045201..1045597),complement(1045069..1045146))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950904"
FT                   /orf_name="Pc13g04350"
FT                   /product="Pc13g04350 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP91504.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI0001830AD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H290"
FT                   /transl_table=1
FT                   /translation="MSHPTEKEKMLRGELYRAFTPELIAARSRCKWACNRFNKSDEVPR
FT                   RRLVEMWRDITDDKTPLPPKLDDPAADEALFAKEPWVESPVHIDYGFNVKLGEGVFVNF
FT                   NCVFIDTCPITVGARTLFGPNVSLFSGTHPLDPALRNGTEGPETGNPIVIGEDCWLGGN
FT                   VTVLPGVTIGKGATIGAGSVVTKDVPAFHVAAGNPAKIIRRIETTMKE"
     MSHPTEKEKM LRGELYRAFT PELIAARSRC KWACNRFNKS DEVPRRRLVE MWRDITDDKT        60
     PLPPKLDDPA ADEALFAKEP WVESPVHIDY GFNVKLGEGV FVNFNCVFID TCPITVGART       120
     LFGPNVSLFS GTHPLDPALR NGTEGPETGN PIVIGEDCWL GGNVTVLPGV TIGKGATIGA       180
     GSVVTKDVPA FHVAAGNPAK IIRRIETTMK E                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page