(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE438

PENCW_10.PE438       Location/Qualifiers
FT   CDS             join(1049856..1050145,1050214..1050334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950906"
FT                   /orf_name="Pc13g04380"
FT                   /product="Pc13g04380 protein"
FT                   /protein_id="CAP91507.1"
FT                   /db_xref="InterPro:IPR019334"
FT                   /db_xref="UniParc:UPI0001830AD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H293"
FT                   /transl_table=1
FT                   /translation="MANNRIPINYEVPSFPSLYDPLPAHHQQAYYLYYTKDIWRFTFFW
FT                   TLIFYAATHLTVSGCAALTHFRNWNVIWIVPLVYIFIAALEALIAGSIIGVVLGAVYEA
FT                   GNFRMSTWLPMIWGGVNVMVLIVTSFPMQGGL"
     MANNRIPINY EVPSFPSLYD PLPAHHQQAY YLYYTKDIWR FTFFWTLIFY AATHLTVSGC        60
     AALTHFRNWN VIWIVPLVYI FIAALEALIA GSIIGVVLGA VYEAGNFRMS TWLPMIWGGV       120
     NVMVLIVTSF PMQGGL                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page