(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE439

PENCW_10.PE439       Location/Qualifiers
FT   CDS             join(complement(1052513..1052597),
FT                   complement(1052315..1052430),complement(1052058..1052258),
FT                   complement(1050592..1051995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825168"
FT                   /orf_name="Pc13g04390"
FT                   /product="Pc13g04390 protein"
FT                   /protein_id="CAP91508.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001830ADA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H294"
FT                   /transl_table=1
FT                   /translation="MAYYEDNAGDGPGRFGKNFDGPVGPRRPRLVTDYGSSMVQWMRTQ
FT                   QPRYKGGHRLETERPSASFAVDVLPPMARPHSAVDTIPVRHLHQSIGKSKKPIVVVRWT
FT                   PEGRRLLTGGHTGEFMLWNGTAFNFETVMDAHYDQIQAGVTSLAWAHSQDWLVSGGQRG
FT                   DIKYWRPNFNNVETIDDAHHDAVRDLAWAPSDTKFLSASDDTTLKIFDFATRTADETLT
FT                   GHNWDVKSCDWHPTKGLIVSGSKDHQVKFWDPRTGRCLTTLHSHKNTVTSTRFSRVNSN
FT                   LLATSSRDQTARVFDLRMMRDICILRGHDKPVSSLTWHPIHSNLISTGAEDGSLYHYLL
FT                   DEPHLPAGQIPTVAPYDSPDPANTPPQVIYPAHRIQYAHGATIWSLDWHPLGHILASGS
FT                   KDNFTRFWSRSRPGETSYMKDRFHIGEEAAEAQGTWNRGFGRKQMRDDEEQEMQDEADS
FT                   LVDQRRPGGPALPGIQSAPPAGPQPDVVGLLPGIGSAQPRQPGMDGGAMSGMDPGRLAA
FT                   LMSSRPPSQSSTPTPAMHGFPMPQGMTGTPPMNMDLAQLQKQLQGFPMPQNLNLQALAN
FT                   NPGFPGGFGGLPGLQGGGTPDGNRR"
     MAYYEDNAGD GPGRFGKNFD GPVGPRRPRL VTDYGSSMVQ WMRTQQPRYK GGHRLETERP        60
     SASFAVDVLP PMARPHSAVD TIPVRHLHQS IGKSKKPIVV VRWTPEGRRL LTGGHTGEFM       120
     LWNGTAFNFE TVMDAHYDQI QAGVTSLAWA HSQDWLVSGG QRGDIKYWRP NFNNVETIDD       180
     AHHDAVRDLA WAPSDTKFLS ASDDTTLKIF DFATRTADET LTGHNWDVKS CDWHPTKGLI       240
     VSGSKDHQVK FWDPRTGRCL TTLHSHKNTV TSTRFSRVNS NLLATSSRDQ TARVFDLRMM       300
     RDICILRGHD KPVSSLTWHP IHSNLISTGA EDGSLYHYLL DEPHLPAGQI PTVAPYDSPD       360
     PANTPPQVIY PAHRIQYAHG ATIWSLDWHP LGHILASGSK DNFTRFWSRS RPGETSYMKD       420
     RFHIGEEAAE AQGTWNRGFG RKQMRDDEEQ EMQDEADSLV DQRRPGGPAL PGIQSAPPAG       480
     PQPDVVGLLP GIGSAQPRQP GMDGGAMSGM DPGRLAALMS SRPPSQSSTP TPAMHGFPMP       540
     QGMTGTPPMN MDLAQLQKQL QGFPMPQNLN LQALANNPGF PGGFGGLPGL QGGGTPDGNR       600
     R                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page