(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE44

PENCW_10.PE44        Location/Qualifiers
FT   CDS             join(complement(107391..107694),complement(107234..107304))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128940"
FT                   /orf_name="Pc13g00440"
FT                   /product="Putative uncharacterized protein Pc13g00440 "
FT                   /protein_id="CAP91113.1"
FT                   /db_xref="UniParc:UPI0001830E92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H172"
FT                   /transl_table=1
FT                   /translation="MPLISRQPTHPAGDELDTMPLLVRRPNTRPSRKSKGANSPAQSTL
FT                   QRDQPTLRLRLQQRCMTPEAWWTSLTAFGAHDNISKHMLEHEKAIATEEIRQEWMRLSA
FT                   GETMFQGNEPSITRELSCLS"
     MPLISRQPTH PAGDELDTMP LLVRRPNTRP SRKSKGANSP AQSTLQRDQP TLRLRLQQRC        60
     MTPEAWWTSL TAFGAHDNIS KHMLEHEKAI ATEEIRQEWM RLSAGETMFQ GNEPSITREL       120
     SCLS                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page