(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE440

PENCW_10.PE440       Location/Qualifiers
FT   CDS             join(1053048..1053285,1053335..1053379,1053480..1054430,
FT                   1054478..1054662,1054761..1054784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950907"
FT                   /orf_name="Pc13g04400"
FT                   /product="Pc13g04400 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91509.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0001830ADB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H295"
FT                   /transl_table=1
FT                   /translation="MTTRTGAIASAREESQLNSRKGVQNETEVALPSTSTAKKRSKYRH
FT                   VAAYHSESRPSSLSREADVLPNFLGFRNLMVLVLVAMNLRLVIENFMKVDVVLGSILFA
FT                   SVPCHLLVAYIIELSAATAAKQTVGRQKKTEKEKEHDQKVFQSTWPYTAFLHTLNATLC
FT                   LAVTSFVVYFYIHHPGIGTICQLHAIIVWLKNCSYAFTNRDLRLALLNPSADPGLPKIY
FT                   SSCPYPRNITINNLAYFWLAPTLVYQPVYPRTASIRWSFVAKRLAEFVGLAVFIWLLSA
FT                   QYAAPVLRNSIDKIAVMDIASILERVMKLSTISLIIWLAGFFALFQALLNALAEVMRFG
FT                   DREFYTDWWNSSSLGMYWRSWNRPVYLFMKRHVYSPLVGRGWSPLAASGMVFTLSAILH
FT                   EMLVGIPTHNFIGVAFFGMMFQLPLISLTAPLDNMRGPEGRVIGNCIFWVSFCLVGQPL
FT                   GALLYFFAWQAKYGSFSLGMYS"
     MTTRTGAIAS AREESQLNSR KGVQNETEVA LPSTSTAKKR SKYRHVAAYH SESRPSSLSR        60
     EADVLPNFLG FRNLMVLVLV AMNLRLVIEN FMKVDVVLGS ILFASVPCHL LVAYIIELSA       120
     ATAAKQTVGR QKKTEKEKEH DQKVFQSTWP YTAFLHTLNA TLCLAVTSFV VYFYIHHPGI       180
     GTICQLHAII VWLKNCSYAF TNRDLRLALL NPSADPGLPK IYSSCPYPRN ITINNLAYFW       240
     LAPTLVYQPV YPRTASIRWS FVAKRLAEFV GLAVFIWLLS AQYAAPVLRN SIDKIAVMDI       300
     ASILERVMKL STISLIIWLA GFFALFQALL NALAEVMRFG DREFYTDWWN SSSLGMYWRS       360
     WNRPVYLFMK RHVYSPLVGR GWSPLAASGM VFTLSAILHE MLVGIPTHNF IGVAFFGMMF       420
     QLPLISLTAP LDNMRGPEGR VIGNCIFWVS FCLVGQPLGA LLYFFAWQAK YGSFSLGMYS       480
//

If you have problems or comments...

PBIL Back to PBIL home page