(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE441

PENCW_10.PE441       Location/Qualifiers
FT   CDS             join(1055142..1055173,1055236..1055371,1055473..1055760)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950908"
FT                   /orf_name="Pc13g04410"
FT                   /product="Pc13g04410 protein"
FT                   /protein_id="CAP91510.1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="UniParc:UPI0001830B82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H287"
FT                   /transl_table=1
FT                   /translation="MVAFIVPGNYGAVIGVALGAIPVLGFVHGNITGSLRKQAKVPYPH
FT                   SYASMELCRENAKAEQFNCAQRAHTNFLENASQTMLFTLVAGLKYPEWAAGLGALWVFF
FT                   RALFLYGYVYSGKPQGKGRMIGGFFWLVQGALWGLSVYGVGRPLLSF"
     MVAFIVPGNY GAVIGVALGA IPVLGFVHGN ITGSLRKQAK VPYPHSYASM ELCRENAKAE        60
     QFNCAQRAHT NFLENASQTM LFTLVAGLKY PEWAAGLGAL WVFFRALFLY GYVYSGKPQG       120
     KGRMIGGFFW LVQGALWGLS VYGVGRPLLS F                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page