(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE443

PENCW_10.PE443       Location/Qualifiers
FT   CDS             join(1058031..1058283,1058406..1058501,1058577..1058782,
FT                   1058872..1059291,1059343..1059691,1059748..1059932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950909"
FT                   /orf_name="Pc13g04430"
FT                   /product="Pc13g04430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91512.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830B84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A5"
FT                   /transl_table=1
FT                   /translation="MASEEKAIGISSGVDTGFDVGKTKHVDPTMEKHAHDADEALKALG
FT                   DLQGETIELDEATNRRLLSVIDWHMMPIMCFVYGMNYLDKTTLSYASVMGIKKDLNLEG
FT                   DQYQWLGSLFYFGYLAWEYPTNRLLQRLPLGKYSAACILIWGLILSCFAAVSNYQGAIA
FT                   IRFMLGVFEAAVTPGFALLTSQWYTKQEQGSRVNIWFSFNGVGQIFGGVVAYGIAVGTE
FT                   KHGSSIEPWKIVFLVTGLLTICLGLVFLWIVPDNQLNARWLNEEDRILAVARVRVNQQG
FT                   IGNKHFKLYQVKEALLDPMTWAFFFYALIADIPNGGITNFFNQLITSFGYNEKESLILG
FT                   VPGGAVEIVALLLNGYVGHIAGQRILASLGGLVAAIVGMLLIVALPLSNNVGRLIGYYL
FT                   TQASPTPFVALLSLISSNVAGYTKKTTVAALYLIGYCAGNIIGPQTFRPKDAPRYVPAE
FT                   VTIIVCWGVCLFLLVGVWMWYRRENQKKLLFTARPEYVRLENQE"
     MASEEKAIGI SSGVDTGFDV GKTKHVDPTM EKHAHDADEA LKALGDLQGE TIELDEATNR        60
     RLLSVIDWHM MPIMCFVYGM NYLDKTTLSY ASVMGIKKDL NLEGDQYQWL GSLFYFGYLA       120
     WEYPTNRLLQ RLPLGKYSAA CILIWGLILS CFAAVSNYQG AIAIRFMLGV FEAAVTPGFA       180
     LLTSQWYTKQ EQGSRVNIWF SFNGVGQIFG GVVAYGIAVG TEKHGSSIEP WKIVFLVTGL       240
     LTICLGLVFL WIVPDNQLNA RWLNEEDRIL AVARVRVNQQ GIGNKHFKLY QVKEALLDPM       300
     TWAFFFYALI ADIPNGGITN FFNQLITSFG YNEKESLILG VPGGAVEIVA LLLNGYVGHI       360
     AGQRILASLG GLVAAIVGML LIVALPLSNN VGRLIGYYLT QASPTPFVAL LSLISSNVAG       420
     YTKKTTVAAL YLIGYCAGNI IGPQTFRPKD APRYVPAEVT IIVCWGVCLF LLVGVWMWYR       480
     RENQKKLLFT ARPEYVRLEN QE                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page