(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE445

PENCW_10.PE445       Location/Qualifiers
FT   CDS             join(complement(1063598..1063629),
FT                   complement(1063123..1063483),complement(1062874..1063047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950910"
FT                   /orf_name="Pc13g04450"
FT                   /product="Pc13g04450 protein"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91514.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0001830B86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H297"
FT                   /transl_table=1
FT                   /translation="MVRELKHHEKKLLRKVDFHNYKSDGNHREHEIRQRYLLQDPMDYR
FT                   KYNALCGSLRQLAHKLSQLDPDADPLRKKLESELLEKLWRMGILKQSREQGAGLSKVER
FT                   EVTVSALCRRRLAVFMVRSGMVETIKAATTFIEQGHVRVGTEVVNDPAFLVTRNMEDFV
FT                   TWVDSSKIKRNILRYREKLDDFDLL"
     MVRELKHHEK KLLRKVDFHN YKSDGNHREH EIRQRYLLQD PMDYRKYNAL CGSLRQLAHK        60
     LSQLDPDADP LRKKLESELL EKLWRMGILK QSREQGAGLS KVEREVTVSA LCRRRLAVFM       120
     VRSGMVETIK AATTFIEQGH VRVGTEVVND PAFLVTRNME DFVTWVDSSK IKRNILRYRE       180
     KLDDFDLL                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page