(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE446

PENCW_10.PE446       Location/Qualifiers
FT   CDS             join(1063858..1064844,1064904..1065434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978332"
FT                   /orf_name="Pc13g04460"
FT                   /product="Pc13g04460 protein"
FT                   /protein_id="CAP91515.1"
FT                   /db_xref="UniParc:UPI0001830B87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H298"
FT                   /transl_table=1
FT                   /translation="MENQADTPSKMSGRPRVDLEPYKAEIIGLYEKKMKSDDICKHMKR
FT                   QHDIQISARTLTKRLQLWGVKKKMENNSSNEALHARIKNLFFDVGLTDQEIVTVLHDEG
FT                   YDVSARTLRRLRHQLGIRLRLDSPTQQQAQVQEILDALTEEMDKGTIEGYGKELLHNHF
FT                   RSKGYVFARDRLYSVYRMLRPDTVERRTRDMHRPPPPPKILAGPNLTWHVNGYSKLANF
FT                   GFRIHAELDAYSRYVLWIHVGVDAHASVGVLKNHLDTVASKNRQPRTLRSDLESEVPLL
FT                   ADAHFALRRVTEPDVQREQCCAPGRATDTHRIESWWAQLAKSVVTLYHNYFRELHNQGL
FT                   FSSTVIPEQVALLAIYMPTLRSHIKSYVQTWNMHNIRKQADHPERAPGKPYMNYHHPPK
FT                   GVENFGLPADVPMLQSMQQNHADYDTEQYLPPDTLHWCEMQLQQLGFDPHKPPARLPGD
FT                   LQPFRSVYLALRERAWHHERSGAEPKLAVCAFPGQGLRGYFPSGHAR"
     MENQADTPSK MSGRPRVDLE PYKAEIIGLY EKKMKSDDIC KHMKRQHDIQ ISARTLTKRL        60
     QLWGVKKKME NNSSNEALHA RIKNLFFDVG LTDQEIVTVL HDEGYDVSAR TLRRLRHQLG       120
     IRLRLDSPTQ QQAQVQEILD ALTEEMDKGT IEGYGKELLH NHFRSKGYVF ARDRLYSVYR       180
     MLRPDTVERR TRDMHRPPPP PKILAGPNLT WHVNGYSKLA NFGFRIHAEL DAYSRYVLWI       240
     HVGVDAHASV GVLKNHLDTV ASKNRQPRTL RSDLESEVPL LADAHFALRR VTEPDVQREQ       300
     CCAPGRATDT HRIESWWAQL AKSVVTLYHN YFRELHNQGL FSSTVIPEQV ALLAIYMPTL       360
     RSHIKSYVQT WNMHNIRKQA DHPERAPGKP YMNYHHPPKG VENFGLPADV PMLQSMQQNH       420
     ADYDTEQYLP PDTLHWCEMQ LQQLGFDPHK PPARLPGDLQ PFRSVYLALR ERAWHHERSG       480
     AEPKLAVCAF PGQGLRGYFP SGHAR                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page