(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE447

PENCW_10.PE447       Location/Qualifiers
FT   CDS             join(complement(1073680..1073910),
FT                   complement(1073194..1073607),complement(1072354..1073138),
FT                   complement(1071794..1072248),complement(1070587..1071737),
FT                   complement(1066644..1070537),complement(1065749..1066594))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950911"
FT                   /orf_name="Pc13g04470"
FT                   /product="Pc13g04470 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91516.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001830B88"
FT                   /db_xref="UniProtKB/TrEMBL:B6H299"
FT                   /transl_table=1
FT                   /translation="MRPLSLASGLSGDGAIPPDSLEAIAIVGLATRFPQQATTTESLWE
FT                   LLLQARSTWSSIPKERFNSDAFYHPDPEHGGTFHVQGGHYLSEDPAYFDGSFFNITKNE
FT                   LLTLDPQQRLVLENVYHALENAGIPLTSAVGSNTSVFVSGFNHDYLGILNSDPETTLKY
FT                   KPTGVTNAILSNRVSWFFDFKGPSMTIDTACSSSLVALHLAVQSLRARETNMAVVSGVS
FT                   ILENPTETIGMSHHGLLGPQGRSFSFDSRAEGYARGEGVGTVVVKPLSAAIRDGDTIRA
FT                   VIRETGVNQDGRTPGITVPSADAQERLIREVYWRAGLGLENTRFVEAHGTGTSTGDPIE
FT                   AGALAKAFKCQRETPLYVGAIKSSIGHLEGGSGVASIIKSILTLESGIIPANFDMKQTN
FT                   PSIPAADWNIAFPTEALPWPSPGLRRVSVNSFGIGGTNAHCILDDAYHYLNDRRLTCAH
FT                   RTTSTVPTTQKIKSRLLALFCASPTFTSSTYTSLVEKPKVFLLSAFDEDGVKRNAAEFA
FT                   KYLNRRTSQSVLHDHLLDDLSFTLSKKRSQFPWKSFIMATSVKELAWNLSESNFAKPTR
FT                   AARVPEVEFVFTGQGAQYQAMGRELMVYPAFQESVEEASEYIRRLGSPWSLLDELLTER
FT                   ESPRVNLPEIAHPLCTVLQIALVDLLASWQIFPKRVTGHSSGEIAAAYCSGKLSREGAW
FT                   KVAYYRGYVSSKQLSANGAMMAVGLGASQLQPYLDSVKGKNTGELIIACHNSPKNNTVS
FT                   GDDAMIDRLRSLLDADGIFARKLNVKNAYHSAHMHAIAQDYLRLMGTLPYGRRLAAPHQ
FT                   VHMFSTVTGHQVKEEHLPAQYWVDNMVSPVLFTSGLVAMTSNASSSHGTTDLADSLRLL
FT                   VEIGPHSTLQSAIKETLASKSPKLEFKYLGVLKRTNHSLNTLLTTVGFLASSGCELDFH
FT                   AVNQAPHSKAKRRPRLLVDLPPYIFKHTEKILFESRLSKNIRTRKFPRHDLFGAPITDW
FT                   NPTAPRWRHFVRLNENPWLRDHMVTGNYVYPGVGYLIMAIEASRQLAGEEKITGFRLQK
FT                   VNIRRALIIPDTKEGIEVSLAMATVEDSASSRTWRRFQITSYNASSDEWTDHCTGHITV
FT                   DHETASDPVDNGREAEEESRAWGSEHFRANETCTKSMAFKSTYNNLQTSGLNFGPLFRN
FT                   LADVRASGCGLGKVVGSVTVPDIAQSMPKQYLHSHLIHPATMDSMIHLMIAAVLDFTGK
FT                   STLDQIRLPTFIRDVWVSADLNSAPTHKFTGHASVSTAESDKFEGQIQMLDEGTNRHRI
FT                   RMDGIELTPLESGLAENSERKLCSAIEYKPDVHFLDSKSACALTSLDASDDTQALYWVK
FT                   RLQLATMLYVMDALKELGDLHVTKLDLHMRRFFDWMEHVQTMLKRDEILHLPYNEFLEI
FT                   AQDEALKEAIGKEIEAHSAEGAITARMGRNIAKVVRQETDPLDLMFGQDAVMEQVYKEG
FT                   LHLYNLPQHLQTHLSLIRHQHSELNILEIGGGTGSFTAEVLAVLSPDLAKTKGNIASYT
FT                   FTDISSGFFEKAKQRFQPWSDIMNFQSLNIERSPVDQGFQLGTYDLIFAGNVIHATANL
FT                   HNALSNLRSLLKPGGQLIMQEGIRQDFLWYPLVFGQLPGWWLGDEPCRQWCPYIPAEEW
FT                   NPLLLKAGFSGIDAEYPSSNDPDLTWQSILVSSAVKIPTEKPSNTAIILTLGTLKARQV
FT                   TENLQVLLPELGYTSILVKEPMEVENSILSDALCISLMDLEYPYLFDMTEAEYDTLKKM
FT                   LSECQNLLWVTCNPLTQPHTSMSFGLLRTVRRERDADGSNIVTLTEAEPDVASPQNLAT
FT                   AVGKIIKRQFVDKPENDRHAEYMLQNGLIHIGRLNEWEAADQFLAAQSSQQAPQLQRLG
FT                   DYDTPIELQEAAVSTGEYHWVIDTQQEESHKDTEVEVEIRAIGLSSDVSAGRLANEIAG
FT                   VVSKVGSEVEDLAAGDRVIYISGDKKGGSVRTHGRADQLQLVRIPDEISFEVAAGLAWA
FT                   YATAIQGLGEMARLGPENTILIHTGATDISQAATQYAQMIGATIYATVATVEERDLLVS
FT                   DYGISKERIFSRKDLKFVKSVMRCTNHTGVDVVFNALSGEALRGSMACLAPFGTFVDVS
FT                   NPNKRADTTVEMASLPRNVSVHTVNVPLMAQHRPKSVRLLLTEALRLYSEGKIGQLRTT
FT                   TVLDFTQIKGGIRTAQSGEAAKVVIAPNPSNMVPVVPRPIVPCHFDPDASYVLAGGYGG
FT                   LGRSLARWMASGGATSLIILSRSSASSQEKMELIADLDRMGCKVHSLVCDVADVSSLQR
FT                   LSGEAFSDLPPIKGCIQASMVLRDGAFTGLSFNDWQAAIKPKVQGSWNLHTVLPDDMDF
FT                   FIMLSSVAGIFGNRGQSNYAAGNTFQDALAAYRVSKGMQAASINLGSVSNVGWVAENRS
FT                   SMRTHTATLFELLREEEVHATVDFLIRQDGGNASACSQLVLGLPTAEMCRQNGVPLPTY
FT                   LNYSMFTHFRSTVTAKNSEVSQQKSVSVAALLSAADGFEGAVIVVSDGIVERLASLLAI
FT                   PCSELDAQRFGFGGIDSLVAMEFRAWIVKELKAEVSLLDIMGAENIRALSEKIAGRSRL
FT                   IAGGSSMSS"
     MRPLSLASGL SGDGAIPPDS LEAIAIVGLA TRFPQQATTT ESLWELLLQA RSTWSSIPKE        60
     RFNSDAFYHP DPEHGGTFHV QGGHYLSEDP AYFDGSFFNI TKNELLTLDP QQRLVLENVY       120
     HALENAGIPL TSAVGSNTSV FVSGFNHDYL GILNSDPETT LKYKPTGVTN AILSNRVSWF       180
     FDFKGPSMTI DTACSSSLVA LHLAVQSLRA RETNMAVVSG VSILENPTET IGMSHHGLLG       240
     PQGRSFSFDS RAEGYARGEG VGTVVVKPLS AAIRDGDTIR AVIRETGVNQ DGRTPGITVP       300
     SADAQERLIR EVYWRAGLGL ENTRFVEAHG TGTSTGDPIE AGALAKAFKC QRETPLYVGA       360
     IKSSIGHLEG GSGVASIIKS ILTLESGIIP ANFDMKQTNP SIPAADWNIA FPTEALPWPS       420
     PGLRRVSVNS FGIGGTNAHC ILDDAYHYLN DRRLTCAHRT TSTVPTTQKI KSRLLALFCA       480
     SPTFTSSTYT SLVEKPKVFL LSAFDEDGVK RNAAEFAKYL NRRTSQSVLH DHLLDDLSFT       540
     LSKKRSQFPW KSFIMATSVK ELAWNLSESN FAKPTRAARV PEVEFVFTGQ GAQYQAMGRE       600
     LMVYPAFQES VEEASEYIRR LGSPWSLLDE LLTERESPRV NLPEIAHPLC TVLQIALVDL       660
     LASWQIFPKR VTGHSSGEIA AAYCSGKLSR EGAWKVAYYR GYVSSKQLSA NGAMMAVGLG       720
     ASQLQPYLDS VKGKNTGELI IACHNSPKNN TVSGDDAMID RLRSLLDADG IFARKLNVKN       780
     AYHSAHMHAI AQDYLRLMGT LPYGRRLAAP HQVHMFSTVT GHQVKEEHLP AQYWVDNMVS       840
     PVLFTSGLVA MTSNASSSHG TTDLADSLRL LVEIGPHSTL QSAIKETLAS KSPKLEFKYL       900
     GVLKRTNHSL NTLLTTVGFL ASSGCELDFH AVNQAPHSKA KRRPRLLVDL PPYIFKHTEK       960
     ILFESRLSKN IRTRKFPRHD LFGAPITDWN PTAPRWRHFV RLNENPWLRD HMVTGNYVYP      1020
     GVGYLIMAIE ASRQLAGEEK ITGFRLQKVN IRRALIIPDT KEGIEVSLAM ATVEDSASSR      1080
     TWRRFQITSY NASSDEWTDH CTGHITVDHE TASDPVDNGR EAEEESRAWG SEHFRANETC      1140
     TKSMAFKSTY NNLQTSGLNF GPLFRNLADV RASGCGLGKV VGSVTVPDIA QSMPKQYLHS      1200
     HLIHPATMDS MIHLMIAAVL DFTGKSTLDQ IRLPTFIRDV WVSADLNSAP THKFTGHASV      1260
     STAESDKFEG QIQMLDEGTN RHRIRMDGIE LTPLESGLAE NSERKLCSAI EYKPDVHFLD      1320
     SKSACALTSL DASDDTQALY WVKRLQLATM LYVMDALKEL GDLHVTKLDL HMRRFFDWME      1380
     HVQTMLKRDE ILHLPYNEFL EIAQDEALKE AIGKEIEAHS AEGAITARMG RNIAKVVRQE      1440
     TDPLDLMFGQ DAVMEQVYKE GLHLYNLPQH LQTHLSLIRH QHSELNILEI GGGTGSFTAE      1500
     VLAVLSPDLA KTKGNIASYT FTDISSGFFE KAKQRFQPWS DIMNFQSLNI ERSPVDQGFQ      1560
     LGTYDLIFAG NVIHATANLH NALSNLRSLL KPGGQLIMQE GIRQDFLWYP LVFGQLPGWW      1620
     LGDEPCRQWC PYIPAEEWNP LLLKAGFSGI DAEYPSSNDP DLTWQSILVS SAVKIPTEKP      1680
     SNTAIILTLG TLKARQVTEN LQVLLPELGY TSILVKEPME VENSILSDAL CISLMDLEYP      1740
     YLFDMTEAEY DTLKKMLSEC QNLLWVTCNP LTQPHTSMSF GLLRTVRRER DADGSNIVTL      1800
     TEAEPDVASP QNLATAVGKI IKRQFVDKPE NDRHAEYMLQ NGLIHIGRLN EWEAADQFLA      1860
     AQSSQQAPQL QRLGDYDTPI ELQEAAVSTG EYHWVIDTQQ EESHKDTEVE VEIRAIGLSS      1920
     DVSAGRLANE IAGVVSKVGS EVEDLAAGDR VIYISGDKKG GSVRTHGRAD QLQLVRIPDE      1980
     ISFEVAAGLA WAYATAIQGL GEMARLGPEN TILIHTGATD ISQAATQYAQ MIGATIYATV      2040
     ATVEERDLLV SDYGISKERI FSRKDLKFVK SVMRCTNHTG VDVVFNALSG EALRGSMACL      2100
     APFGTFVDVS NPNKRADTTV EMASLPRNVS VHTVNVPLMA QHRPKSVRLL LTEALRLYSE      2160
     GKIGQLRTTT VLDFTQIKGG IRTAQSGEAA KVVIAPNPSN MVPVVPRPIV PCHFDPDASY      2220
     VLAGGYGGLG RSLARWMASG GATSLIILSR SSASSQEKME LIADLDRMGC KVHSLVCDVA      2280
     DVSSLQRLSG EAFSDLPPIK GCIQASMVLR DGAFTGLSFN DWQAAIKPKV QGSWNLHTVL      2340
     PDDMDFFIML SSVAGIFGNR GQSNYAAGNT FQDALAAYRV SKGMQAASIN LGSVSNVGWV      2400
     AENRSSMRTH TATLFELLRE EEVHATVDFL IRQDGGNASA CSQLVLGLPT AEMCRQNGVP      2460
     LPTYLNYSMF THFRSTVTAK NSEVSQQKSV SVAALLSAAD GFEGAVIVVS DGIVERLASL      2520
     LAIPCSELDA QRFGFGGIDS LVAMEFRAWI VKELKAEVSL LDIMGAENIR ALSEKIAGRS      2580
     RLIAGGSSMS S                                                           2591
//

If you have problems or comments...

PBIL Back to PBIL home page