(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE448

PENCW_10.PE448       Location/Qualifiers
FT   CDS             join(complement(1078145..1078314),
FT                   complement(1076939..1078034))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950912"
FT                   /orf_name="Pc13g04480"
FT                   /product="Pc13g04480 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91517.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A0"
FT                   /transl_table=1
FT                   /translation="MQLLRLLVAVAVVLFSVVVIAAEDYYKVLGLAKSASERDIKRAYR
FT                   TLSKKYHPDKNPGDDTAREKFVEIADAYDVLSTSALRKVYDQYGHDGVEQHRKGQAAGG
FT                   SHDPFDLFSRFFGGGGHSGHAPGHRRGPDMEVRAALPLRDFYNGREINFLVEKQQICDS
FT                   CEGTGSKDRQVVTCDRCSGRGMVIQKHMLAPGMFQQVQMQCDKCHGQGKKIKNPCPVCH
FT                   GNRVVKNEVETGATIEPGMGKGTRLVFENEADESPDWVAGDLIVVLDEKEPELGTSEEE
FT                   KTDGTFFRRKGKDLFWKETLSLREAWMGGWTRNLTHLDGHVVRLGRGRGEVVQPLAVET
FT                   IAGEGMPHYSEGHLHDHHDENDEAGNLFVEYTVILPDQMESGMEKDFHALWEKWRKKIG
FT                   VDLAKDSGRPVVSPPAEDKDEL"
     MQLLRLLVAV AVVLFSVVVI AAEDYYKVLG LAKSASERDI KRAYRTLSKK YHPDKNPGDD        60
     TAREKFVEIA DAYDVLSTSA LRKVYDQYGH DGVEQHRKGQ AAGGSHDPFD LFSRFFGGGG       120
     HSGHAPGHRR GPDMEVRAAL PLRDFYNGRE INFLVEKQQI CDSCEGTGSK DRQVVTCDRC       180
     SGRGMVIQKH MLAPGMFQQV QMQCDKCHGQ GKKIKNPCPV CHGNRVVKNE VETGATIEPG       240
     MGKGTRLVFE NEADESPDWV AGDLIVVLDE KEPELGTSEE EKTDGTFFRR KGKDLFWKET       300
     LSLREAWMGG WTRNLTHLDG HVVRLGRGRG EVVQPLAVET IAGEGMPHYS EGHLHDHHDE       360
     NDEAGNLFVE YTVILPDQME SGMEKDFHAL WEKWRKKIGV DLAKDSGRPV VSPPAEDKDE       420
     L                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page