(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE449

PENCW_10.PE449       Location/Qualifiers
FT   CDS             join(complement(1079550..1079903),
FT                   complement(1079115..1079528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950913"
FT                   /orf_name="Pc13g04490"
FT                   /product="Pc13g04490 protein"
FT                   /protein_id="CAP91518.1"
FT                   /db_xref="UniParc:UPI0001830B8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A1"
FT                   /transl_table=1
FT                   /translation="MTGFHFSGQQLDNDLVTSISCLLDAADIPNLLWGNYLLTIYGVPT
FT                   VVDVSISLQRSVVGTLLILRQGVSFVVPDTLIEISYSTLSKAGFLPCTQSSDCPYSNTL
FT                   RCPPPVTHLHIDDEKSDVLWEFPDFEIASHNNNSDIWCASDTRLPPASLGRGQGRFPPH
FT                   LYSVQIPSALRYCEALILLLCRDYGSVCETYWMAILTYMLEFVDGTDILDEEGLSEGYR
FT                   PFYRALKQADSRMYLLLEELRRDLIERRILPVK"
     MTGFHFSGQQ LDNDLVTSIS CLLDAADIPN LLWGNYLLTI YGVPTVVDVS ISLQRSVVGT        60
     LLILRQGVSF VVPDTLIEIS YSTLSKAGFL PCTQSSDCPY SNTLRCPPPV THLHIDDEKS       120
     DVLWEFPDFE IASHNNNSDI WCASDTRLPP ASLGRGQGRF PPHLYSVQIP SALRYCEALI       180
     LLLCRDYGSV CETYWMAILT YMLEFVDGTD ILDEEGLSEG YRPFYRALKQ ADSRMYLLLE       240
     ELRRDLIERR ILPVK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page