(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE45

PENCW_10.PE45        Location/Qualifiers
FT   CDS             join(108837..108909,108956..109194,109254..109637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128941"
FT                   /orf_name="Pc13g00450"
FT                   /product="Pc13g00450 protein"
FT                   /protein_id="CAP91114.1"
FT                   /db_xref="UniParc:UPI0001830E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H173"
FT                   /transl_table=1
FT                   /translation="MVLTSNERRAFFRQQCREALAAHIYDRLGLVVAPSDVRLQPSVGD
FT                   KYAWSVTESKKSLLQTNLSSGSVGLYRSICEELGRSLEAVTPQTLQFARLERDHLPKEE
FT                   SGPARSDEEGNGSFTAKIRELECANHEIKNELGRTSIHLQESLGENRTLHAKIRQLQDE
FT                   LDSISSRETQLEDELVRISGGITKAMQVLQEYEAHERGMLYGGRQREYCDSTDSMALGI
FT                   PAPIRDEVF"
     MVLTSNERRA FFRQQCREAL AAHIYDRLGL VVAPSDVRLQ PSVGDKYAWS VTESKKSLLQ        60
     TNLSSGSVGL YRSICEELGR SLEAVTPQTL QFARLERDHL PKEESGPARS DEEGNGSFTA       120
     KIRELECANH EIKNELGRTS IHLQESLGEN RTLHAKIRQL QDELDSISSR ETQLEDELVR       180
     ISGGITKAMQ VLQEYEAHER GMLYGGRQRE YCDSTDSMAL GIPAPIRDEV F                231
//

If you have problems or comments...

PBIL Back to PBIL home page