(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE450

PENCW_10.PE450       Location/Qualifiers
FT   CDS             join(complement(1082538..1082931),
FT                   complement(1080637..1082438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950914"
FT                   /orf_name="Pc13g04500"
FT                   /product="Pc13g04500 protein"
FT                   /function="lipid binding"
FT                   /protein_id="CAP91519.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="UniParc:UPI0001830B8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A2"
FT                   /transl_table=1
FT                   /translation="MPSETEPLLPRYEDDTSRQRRLHQKLHSYQMIRAISEGYMPTTEQ
FT                   TIANLRTLLASDVLNLRNQDIGSVGRQLVRDSRLWIQAFIEFLEQKNGQDQLQQFLWRL
FT                   ARSRVEVDSERVSRQAAHVKARADTKAAYDSFRTVGGLLLTNADFRLFVDDIVTVGRQI
FT                   FADTAESLAESSKRVAEQAKPSEEEEQALQGAGADEGHALSKAEVKEEAAHVADVAGEG
FT                   IAQTSHDAVKSAKEHLSGRERDTLLFRLKQAVQRLRERTDYSDSVSTLTQLIARYARIY
FT                   ADVAENTASVAQEELGVNDDLRRAVDEFWIVLRSFGSAEEWDRLQEKFHNVLRHANKDP
FT                   EFDNLLKEVGTSLHDMLTNPEFFDSAPQKLDELKQHSGRVSSETGLRKDVDDFLAQTKC
FT                   TLRTVPEDPAVSKLINATKKIYQDACGAYNDKKADLPADLVNVFFPVLLRTIQYIPIPR
FT                   LEISAPEMDLLLENLVLEPGHTVNFSSFLPYRMHLLTRNDIDVVKTHSKRTETLMKTAF
FT                   TVTVQGLNISAEDFGYWFRAHTGFFHLKDEGIASFYLDRRGIDISLDIEVGRDRLEHIF
FT                   SLRGVRVCIHKLDYTVKRSKWRFLVWLTKPFLKHLVRRVLEKKIAEEIVAATFALNREL
FT                   VFARERLRATRIANPQDLATFVRAVLARLKPADSDVEARIGIEPQGVFKGIYAPGSIVK
FT                   TWHEEATRAQEAIEEGDETQGLGHTWHNDIFNVAGRY"
     MPSETEPLLP RYEDDTSRQR RLHQKLHSYQ MIRAISEGYM PTTEQTIANL RTLLASDVLN        60
     LRNQDIGSVG RQLVRDSRLW IQAFIEFLEQ KNGQDQLQQF LWRLARSRVE VDSERVSRQA       120
     AHVKARADTK AAYDSFRTVG GLLLTNADFR LFVDDIVTVG RQIFADTAES LAESSKRVAE       180
     QAKPSEEEEQ ALQGAGADEG HALSKAEVKE EAAHVADVAG EGIAQTSHDA VKSAKEHLSG       240
     RERDTLLFRL KQAVQRLRER TDYSDSVSTL TQLIARYARI YADVAENTAS VAQEELGVND       300
     DLRRAVDEFW IVLRSFGSAE EWDRLQEKFH NVLRHANKDP EFDNLLKEVG TSLHDMLTNP       360
     EFFDSAPQKL DELKQHSGRV SSETGLRKDV DDFLAQTKCT LRTVPEDPAV SKLINATKKI       420
     YQDACGAYND KKADLPADLV NVFFPVLLRT IQYIPIPRLE ISAPEMDLLL ENLVLEPGHT       480
     VNFSSFLPYR MHLLTRNDID VVKTHSKRTE TLMKTAFTVT VQGLNISAED FGYWFRAHTG       540
     FFHLKDEGIA SFYLDRRGID ISLDIEVGRD RLEHIFSLRG VRVCIHKLDY TVKRSKWRFL       600
     VWLTKPFLKH LVRRVLEKKI AEEIVAATFA LNRELVFARE RLRATRIANP QDLATFVRAV       660
     LARLKPADSD VEARIGIEPQ GVFKGIYAPG SIVKTWHEEA TRAQEAIEEG DETQGLGHTW       720
     HNDIFNVAGR Y                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page