(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE451

PENCW_10.PE451       Location/Qualifiers
FT   CDS             join(1085120..1085205,1085284..1085503,1085581..1085659,
FT                   1085778..1086126,1086199..1087273)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978333"
FT                   /orf_name="Pc13g04510"
FT                   /product="Pc13g04510 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91520.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A3"
FT                   /transl_table=1
FT                   /translation="MARYPLLPTQQNRTVHATPAPFVNHTSPADANYDTANPSYIRKYL
FT                   RTYGLTPPRAEGYETQKARCLAQLGLKSTPIEKFLYLSTLRKNNVHLFYRLVTDHLREL
FT                   TPLIYTPVVGEACQKWSEIYQQPEGMYLSWEDRGNLASVIANWPESNVEITCITDGSRI
FT                   LGLGDLGINGMGIPIGKLALYTACAGIRPEATLPLTLDLGTGNKALREDPLYMGSRRDK
FT                   VSPEEEREFLDELMAALTERWPGIVIQFEDFKNPFPALERYRDMYTCFNDDIQGTGAVI
FT                   LGGVINAVKRSGLPCKDHRAVFFGAGSAGVGVARQIVEFFMREGMTEDEARNCFYLVDT
FT                   KGLVTADRGDKLADHKVYFARRDNNGEQYKTLDEVVDHVKPSILMGLSTMGGVFTPEIL
FT                   RKMADWNTAPLIFPLSNPSSKSECDFETAIANTDGRCLFASGSPFPNCTFTNSAGETRT
FT                   YYPGQGNNMYVFPGIGLGSILSKAVRVTDSMIYASGEALSAALNGEELERGLLYPDITR
FT                   IREVSVVVTRKVMRAAQEDKVDREIALRSLSDVELDNWIKARMYDPHTEVRALEREVGH
FT                   LLSSLGTISPPMTASGSPTEEKNAKL"
     MARYPLLPTQ QNRTVHATPA PFVNHTSPAD ANYDTANPSY IRKYLRTYGL TPPRAEGYET        60
     QKARCLAQLG LKSTPIEKFL YLSTLRKNNV HLFYRLVTDH LRELTPLIYT PVVGEACQKW       120
     SEIYQQPEGM YLSWEDRGNL ASVIANWPES NVEITCITDG SRILGLGDLG INGMGIPIGK       180
     LALYTACAGI RPEATLPLTL DLGTGNKALR EDPLYMGSRR DKVSPEEERE FLDELMAALT       240
     ERWPGIVIQF EDFKNPFPAL ERYRDMYTCF NDDIQGTGAV ILGGVINAVK RSGLPCKDHR       300
     AVFFGAGSAG VGVARQIVEF FMREGMTEDE ARNCFYLVDT KGLVTADRGD KLADHKVYFA       360
     RRDNNGEQYK TLDEVVDHVK PSILMGLSTM GGVFTPEILR KMADWNTAPL IFPLSNPSSK       420
     SECDFETAIA NTDGRCLFAS GSPFPNCTFT NSAGETRTYY PGQGNNMYVF PGIGLGSILS       480
     KAVRVTDSMI YASGEALSAA LNGEELERGL LYPDITRIRE VSVVVTRKVM RAAQEDKVDR       540
     EIALRSLSDV ELDNWIKARM YDPHTEVRAL EREVGHLLSS LGTISPPMTA SGSPTEEKNA       600
     KL                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page