(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE452

PENCW_10.PE452       Location/Qualifiers
FT   CDS             join(1088148..1088219,1088294..1088396,1088558..1088977,
FT                   1089049..1089068,1089154..1089741,1089813..1089860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978334"
FT                   /orf_name="Pc13g04520"
FT                   /product="Pc13g04520 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91521.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830C46"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A8"
FT                   /transl_table=1
FT                   /translation="MPSSPLADPVKLPCGLVLPNRLSKAAMAELLAKNNQPTDPLVDAY
FT                   EQWSDGGWGSILTGNVQVDVNHMGSPFDPALHNEYKDNETNSVLVAQWKKYADACQKHG
FT                   TPAIAQICHPGRQSFRVAGRRGMFAQTLAPSAVPIKVGDSYLERLIGYLAWTEPKEMTT
FT                   QDVEMVIRQFVDTARLMADAGFSGIELHAAHGYLLDQFLNGKTNLRTDAYGGTPEKRTR
FT                   FVLEIISQTRKLVPATFAIGIKLNSADHSSTTFEETMTQIALLAEAGLDFMEISGGSYE
FT                   DPKMMGYGKANATEPKSSRTAAREAFFLEFSKEVRQRHPELVLMLTGGFRSRAGAEAAI
FT                   RDNACDLVGIGRPAAIDAKFPRLLLDESVGDDEARLPLNKAPVPWYTRFLPLHLIGAGA
FT                   ESIQNLGKGIATLAPPW"
     MPSSPLADPV KLPCGLVLPN RLSKAAMAEL LAKNNQPTDP LVDAYEQWSD GGWGSILTGN        60
     VQVDVNHMGS PFDPALHNEY KDNETNSVLV AQWKKYADAC QKHGTPAIAQ ICHPGRQSFR       120
     VAGRRGMFAQ TLAPSAVPIK VGDSYLERLI GYLAWTEPKE MTTQDVEMVI RQFVDTARLM       180
     ADAGFSGIEL HAAHGYLLDQ FLNGKTNLRT DAYGGTPEKR TRFVLEIISQ TRKLVPATFA       240
     IGIKLNSADH SSTTFEETMT QIALLAEAGL DFMEISGGSY EDPKMMGYGK ANATEPKSSR       300
     TAAREAFFLE FSKEVRQRHP ELVLMLTGGF RSRAGAEAAI RDNACDLVGI GRPAAIDAKF       360
     PRLLLDESVG DDEARLPLNK APVPWYTRFL PLHLIGAGAE SIQNLGKGIA TLAPPW           416
//

If you have problems or comments...

PBIL Back to PBIL home page