(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE453

PENCW_10.PE453       Location/Qualifiers
FT   CDS             complement(1090288..1091061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950915"
FT                   /orf_name="Pc13g04530"
FT                   /product="Pc13g04530 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91522.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0001830C47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A6"
FT                   /transl_table=1
FT                   /translation="MENDTQTLQMDHTLSHCPWQADKPQPISRDQWPEEGLQWGSDPSF
FT                   CYHGYSSPIGTWTEERLVQNLMRNMASFCTVMDIGFNIPEIIDEPSEKPILDPPELNGF
FT                   TLPMFQPSMVPRNRRLSETPSSPSSSSSSQGQISSPDNTECSRRASCVKPRTQSGQKKR
FT                   KCVQRPGQRLCHCRSEKRRREIIGERYKELCRIVPGLEKQSFTRKYVLEGAALWIQKLV
FT                   QGNDALHQQLEQLKEREKLNQLRLFPVEEDEKLGC"
     MENDTQTLQM DHTLSHCPWQ ADKPQPISRD QWPEEGLQWG SDPSFCYHGY SSPIGTWTEE        60
     RLVQNLMRNM ASFCTVMDIG FNIPEIIDEP SEKPILDPPE LNGFTLPMFQ PSMVPRNRRL       120
     SETPSSPSSS SSSQGQISSP DNTECSRRAS CVKPRTQSGQ KKRKCVQRPG QRLCHCRSEK       180
     RRREIIGERY KELCRIVPGL EKQSFTRKYV LEGAALWIQK LVQGNDALHQ QLEQLKEREK       240
     LNQLRLFPVE EDEKLGC                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page