(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE454

PENCW_10.PE454       Location/Qualifiers
FT   CDS             join(1091863..1093256,1093315..1093556,1093738..1094022,
FT                   1094076..1094276,1094328..1094590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950916"
FT                   /orf_name="Pc13g04540"
FT                   /product="Pc13g04540 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91523.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A7"
FT                   /transl_table=1
FT                   /translation="MPPKGGITKREPPRRRKIALACESCRDKKVRCDGIKPICGPCARR
FT                   SYTVDQCVYKLDNARSASNDEYLKILHNRIRELEETCAKGGVTVPPGPSQDGDYRAPGS
FT                   QSHMGEDMDLDHLDAESRTSVAAEGLLGLGSTPVPSGPIPLSSTPTFQPPRFPAQRNIP
FT                   EAERYRSPHVTHLSPESTQPRAGSIYPSPSLNSHGNVTAMGAISVAEDEPSTDSPREQQ
FT                   YYGNSSVASFMRLAGESMPLQSYMSALRDSKSESSRSQGPDTGIWRDLGHPSVDLRFDD
FT                   FSLPPRSLADHLLECYWDRVHCLFPFFHRPSFEQAYENLWGSDKASKPELPQLNIGLGG
FT                   AFDCGPNSIVFHCALNCIFAIGCYFSDIPPADREAAVYSFFLRAKRFVNLDLLDIGTIG
FT                   VVQTLLIVSLLLQSTPYPNRCWNAIGLACRAGQGLGLHETTTHASNKPLETEIRRRTWH
FT                   SCVIMDMIVSMTHGRPSMTSHISPLPLPAMGTDSEEADPCELSGQPCDHKLGYMTFYVS
FT                   TIELYKILESILSEVYNAWQSRSNTTRTGSFSFCAFRLQFLTKERFIHLRLLLYRPMFT
FT                   QLCSDERAGSSRRSDSQSSERNIIYSTVFSKCAASCVMAAIDLVSLVYKTYRTNVTDAW
FT                   WYNGFYTSTAGFILIMSYSCHSIREQVDSQIVDESWRKCEEILAFMAIFSLSARNSLQF
FT                   LQVTHQHITQNYSATCRPGDPSMVSTQLHQRGNQQPNRPDLSSQPTEPIADEHNLRHGP
FT                   ANMDINLFSTWDEMSLGQEEFGFLGRFDLPDLASWFADIPP"
     MPPKGGITKR EPPRRRKIAL ACESCRDKKV RCDGIKPICG PCARRSYTVD QCVYKLDNAR        60
     SASNDEYLKI LHNRIRELEE TCAKGGVTVP PGPSQDGDYR APGSQSHMGE DMDLDHLDAE       120
     SRTSVAAEGL LGLGSTPVPS GPIPLSSTPT FQPPRFPAQR NIPEAERYRS PHVTHLSPES       180
     TQPRAGSIYP SPSLNSHGNV TAMGAISVAE DEPSTDSPRE QQYYGNSSVA SFMRLAGESM       240
     PLQSYMSALR DSKSESSRSQ GPDTGIWRDL GHPSVDLRFD DFSLPPRSLA DHLLECYWDR       300
     VHCLFPFFHR PSFEQAYENL WGSDKASKPE LPQLNIGLGG AFDCGPNSIV FHCALNCIFA       360
     IGCYFSDIPP ADREAAVYSF FLRAKRFVNL DLLDIGTIGV VQTLLIVSLL LQSTPYPNRC       420
     WNAIGLACRA GQGLGLHETT THASNKPLET EIRRRTWHSC VIMDMIVSMT HGRPSMTSHI       480
     SPLPLPAMGT DSEEADPCEL SGQPCDHKLG YMTFYVSTIE LYKILESILS EVYNAWQSRS       540
     NTTRTGSFSF CAFRLQFLTK ERFIHLRLLL YRPMFTQLCS DERAGSSRRS DSQSSERNII       600
     YSTVFSKCAA SCVMAAIDLV SLVYKTYRTN VTDAWWYNGF YTSTAGFILI MSYSCHSIRE       660
     QVDSQIVDES WRKCEEILAF MAIFSLSARN SLQFLQVTHQ HITQNYSATC RPGDPSMVST       720
     QLHQRGNQQP NRPDLSSQPT EPIADEHNLR HGPANMDINL FSTWDEMSLG QEEFGFLGRF       780
     DLPDLASWFA DIPP                                                         794
//

If you have problems or comments...

PBIL Back to PBIL home page