(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE455

PENCW_10.PE455       Location/Qualifiers
FT   CDS             join(complement(1097027..1097146),
FT                   complement(1096880..1096974),complement(1096133..1096829),
FT                   complement(1094806..1096083))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672474"
FT                   /orf_name="Pc13g04550"
FT                   /product="Pc13g04550 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91524.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A9"
FT                   /transl_table=1
FT                   /translation="MYELGQSPESSRQTSPASRDHNPRKRGRTACTRCKTRKQKCDNEH
FT                   PACSNCLKAGVSCDKSSVREDKDRQNDYIRGLEERVMFLERKLVESDRSSDQNAAATHT
FT                   ASSLFSPQGGHTTPHTTTSGFDNNPVGEIVGLLALSASEAPAYVGSSSGLSLAADLGEM
FT                   VQTSVWNQFISRMQQKTSTTANNSRNTAGQAQGPTEQSSATQIRDRATRTEDLLPANVE
FT                   PPTDEMGARILETYFTRLHSRYPFLNRNQVWQIHVDRWRLAKIKREDLTRSDRFAIFKL
FT                   NLVYAIGATMLRLSEKYAYTTPERFYTAALQHVPTMCEARSIENIEAMVLLVVYHLRTA
FT                   SSHGMWYMIGLAMRTAIDLGLHRKANESNMDPFTTQMRRRLFWTVYYLERVVSMSLGRP
FT                   FSISDRHIDLDLPLEVDDDIEDPTLLTASLDPNKTTTLTFAIYLFKLRRIDSRIQHKIY
FT                   RADRPLSSLRPKMDPLYLELEQWKESALLRFSGPDLDYPMLHFNRAVRLLIQPFLPLLP
FT                   ITDPYYQICILAAGNICQSHKRLHQTLEYGHSFLAVQTVFMAGITLLYALWTHTDQVWS
FT                   VRMSNDIRACSTVLFVMGERAAWVKKYRDAFELLVNAAMEKLQGNETARNAGMAELMTA
FT                   QYGVNWNSTTAPGMSGSDKFPPVNPTGLAPDTTGATPQGCAGDDSEHAVRMALQLAPWI
FT                   DQDESDPLWVPDFETLENLSGTFWSHGDTRLFDPM"
     MYELGQSPES SRQTSPASRD HNPRKRGRTA CTRCKTRKQK CDNEHPACSN CLKAGVSCDK        60
     SSVREDKDRQ NDYIRGLEER VMFLERKLVE SDRSSDQNAA ATHTASSLFS PQGGHTTPHT       120
     TTSGFDNNPV GEIVGLLALS ASEAPAYVGS SSGLSLAADL GEMVQTSVWN QFISRMQQKT       180
     STTANNSRNT AGQAQGPTEQ SSATQIRDRA TRTEDLLPAN VEPPTDEMGA RILETYFTRL       240
     HSRYPFLNRN QVWQIHVDRW RLAKIKREDL TRSDRFAIFK LNLVYAIGAT MLRLSEKYAY       300
     TTPERFYTAA LQHVPTMCEA RSIENIEAMV LLVVYHLRTA SSHGMWYMIG LAMRTAIDLG       360
     LHRKANESNM DPFTTQMRRR LFWTVYYLER VVSMSLGRPF SISDRHIDLD LPLEVDDDIE       420
     DPTLLTASLD PNKTTTLTFA IYLFKLRRID SRIQHKIYRA DRPLSSLRPK MDPLYLELEQ       480
     WKESALLRFS GPDLDYPMLH FNRAVRLLIQ PFLPLLPITD PYYQICILAA GNICQSHKRL       540
     HQTLEYGHSF LAVQTVFMAG ITLLYALWTH TDQVWSVRMS NDIRACSTVL FVMGERAAWV       600
     KKYRDAFELL VNAAMEKLQG NETARNAGMA ELMTAQYGVN WNSTTAPGMS GSDKFPPVNP       660
     TGLAPDTTGA TPQGCAGDDS EHAVRMALQL APWIDQDESD PLWVPDFETL ENLSGTFWSH       720
     GDTRLFDPM                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page