(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE456

PENCW_10.PE456       Location/Qualifiers
FT   CDS             join(complement(1098650..1099478),
FT                   complement(1098340..1098595),complement(1097612..1098278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950917"
FT                   /orf_name="Pc13g04560"
FT                   /product="Pc13g04560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91525.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B0"
FT                   /transl_table=1
FT                   /translation="MNRQREAEKALHDQTNILPFAQLMVVFTGLAISLLICMVDQNGIS
FT                   VTLPTISRELDAQNTISWAGTSSLIANTMFTVLYGRLSDIFGRKIMYISALVLLCIADL
FT                   LCGLSQSPAMFYVFRGLAGVAGGGVTSLTMIIVSDIVTLEKRGKYQGILGASLGIGNII
FT                   GPFLGAAFIMRSTWRGFFWLISPLAACSAVVGYFLIPNNARKDSFRENVGRIDWFGLLA
FT                   SSIGIIFLLIPISGGGSYFPWDSPMVISMLVIGGCSLVAFLLIEWKVATLPMLPVVFFK
FT                   NKVVSAIFLQSFLYGAVYQASLYYLPLYYQNARGWSPIASAAMTCPMVAAQSIFSITSG
FT                   QYISRVKRYGEIIWIGFGLWTLGSGLMLLFGTHTHPAVIAVIVAVMGAGIGFTFQPTLV
FT                   ALQAHCTKSQRAVVIANRNFFRCIGGSCGLAISAAILQATLRSNLPSKFAYLADSSYSL
FT                   PSRANLSATEWASILLSYSKASHAVFILQVPLIGVCFLACMFVRDRGLERPKELEEIEE
FT                   EKRKAQEERDAEAATSDYPEESVDHQAYRQTEKCHSASTFAEPFMPPSRAEPNTEGCGE
FT                   KEQHRGI"
     MNRQREAEKA LHDQTNILPF AQLMVVFTGL AISLLICMVD QNGISVTLPT ISRELDAQNT        60
     ISWAGTSSLI ANTMFTVLYG RLSDIFGRKI MYISALVLLC IADLLCGLSQ SPAMFYVFRG       120
     LAGVAGGGVT SLTMIIVSDI VTLEKRGKYQ GILGASLGIG NIIGPFLGAA FIMRSTWRGF       180
     FWLISPLAAC SAVVGYFLIP NNARKDSFRE NVGRIDWFGL LASSIGIIFL LIPISGGGSY       240
     FPWDSPMVIS MLVIGGCSLV AFLLIEWKVA TLPMLPVVFF KNKVVSAIFL QSFLYGAVYQ       300
     ASLYYLPLYY QNARGWSPIA SAAMTCPMVA AQSIFSITSG QYISRVKRYG EIIWIGFGLW       360
     TLGSGLMLLF GTHTHPAVIA VIVAVMGAGI GFTFQPTLVA LQAHCTKSQR AVVIANRNFF       420
     RCIGGSCGLA ISAAILQATL RSNLPSKFAY LADSSYSLPS RANLSATEWA SILLSYSKAS       480
     HAVFILQVPL IGVCFLACMF VRDRGLERPK ELEEIEEEKR KAQEERDAEA ATSDYPEESV       540
     DHQAYRQTEK CHSASTFAEP FMPPSRAEPN TEGCGEKEQH RGI                         583
//

If you have problems or comments...

PBIL Back to PBIL home page