(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE457

PENCW_10.PE457       Location/Qualifiers
FT   CDS             complement(1100802..1101968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825170"
FT                   /orf_name="Pc13g04570"
FT                   /product="Pc13g04570 protein"
FT                   /protein_id="CAP91526.1"
FT                   /db_xref="InterPro:IPR004332"
FT                   /db_xref="UniParc:UPI0001830C4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B1"
FT                   /transl_table=1
FT                   /translation="MTEMYSGLHVGQRFCSLEEFKTLVRSISVRQHWELRVARSNKKSV
FT                   VIGCRSSANCFFRVVCRSNKNATYITSLQDSHSCRRSANSPAATPARSEASHVRFLLSE
FT                   IPKLFNMKSKIRAQDVVDAVKRYHGYDISMRQAQRALTKLQPRHAEGQDEHGLDIDMSA
FT                   GEQQSPEQSPESQGEGAHTYGEIPENRWLPEHLPSSLIDDDNMSPNETSNNHIPAPPSS
FT                   SQALPSPQQVQHVPIPTSNQHSFNQNPHSMNIPQSGVEYQTAASLPVGVVGPPKDYSQR
FT                   SDHDAVPQMILTNFKIEFTCTTCGTLNQSFFPNQGNVTGASYMTHHAVPNPGNVPRHAG
FT                   TTPQSGVGSSSNAVGESPAYDINASNPPSIQNAWPGGGLGVQIGPAHT"
     MTEMYSGLHV GQRFCSLEEF KTLVRSISVR QHWELRVARS NKKSVVIGCR SSANCFFRVV        60
     CRSNKNATYI TSLQDSHSCR RSANSPAATP ARSEASHVRF LLSEIPKLFN MKSKIRAQDV       120
     VDAVKRYHGY DISMRQAQRA LTKLQPRHAE GQDEHGLDID MSAGEQQSPE QSPESQGEGA       180
     HTYGEIPENR WLPEHLPSSL IDDDNMSPNE TSNNHIPAPP SSSQALPSPQ QVQHVPIPTS       240
     NQHSFNQNPH SMNIPQSGVE YQTAASLPVG VVGPPKDYSQ RSDHDAVPQM ILTNFKIEFT       300
     CTTCGTLNQS FFPNQGNVTG ASYMTHHAVP NPGNVPRHAG TTPQSGVGSS SNAVGESPAY       360
     DINASNPPSI QNAWPGGGLG VQIGPAHT                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page