(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE459

PENCW_10.PE459       Location/Qualifiers
FT   CDS             join(complement(1103993..1104160),
FT                   complement(1103824..1103910),complement(1103656..1103757))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950919"
FT                   /orf_name="Pc13g04590"
FT                   /product="Pc13g04590 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="tubulin complex assembly"
FT                   /cellular_component="microtubule"
FT                   /protein_id="CAP91528.1"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007021"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="UniParc:UPI0001830C4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B3"
FT                   /transl_table=1
FT                   /translation="MAPRTQLEITTSSVIRLVKEEASYHNELQQQAERIKKLEADTTDG
FT                   DENREYTLKQEHMSLEETKKVLPTLKEKIVQTVANLEALIIEEGKKGSESNVEHITAAK
FT                   EAIAQAKTAQREIS"
     MAPRTQLEIT TSSVIRLVKE EASYHNELQQ QAERIKKLEA DTTDGDENRE YTLKQEHMSL        60
     EETKKVLPTL KEKIVQTVAN LEALIIEEGK KGSESNVEHI TAAKEAIAQA KTAQREIS         118
//

If you have problems or comments...

PBIL Back to PBIL home page