(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE460

PENCW_10.PE460       Location/Qualifiers
FT   CDS             join(1105292..1105349,1105414..1105490,1105571..1106530)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825171"
FT                   /orf_name="Pc13g04600"
FT                   /product="Pc13g04600 protein"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91529.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniParc:UPI0001830C4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B4"
FT                   /transl_table=1
FT                   /translation="MPAPSLLHLATATAIRFVKDLDDLGAMPYSLARPILLNIQNPEKL
FT                   HAMELASPHLAEEDEELWLELIKRDIPDWEKYHLPDNTNNWYGVYCDLRDQAQRSLDAD
FT                   AERMKMAIDGISAKRALLTPKLIPERKGLRMAGSRPSFRQRHATYNHRTGGGGVEKKPS
FT                   IFQPQKRNTALTMPTKSLNNRASQVKRAPIGLVEEHRRPAEQAAPKPPSKAQPLPPRIS
FT                   RRPGMSPPSLQHPMLAKNEARLRALTSTASAAASPRGASSNDASGVKKSPAVATEPKPT
FT                   LKRRATSPPHGAENPSASSSSRPAPCAPSSSSSSSSSSLPIPHTSSLPPSGPPSSGPPT
FT                   PRPGVIRRRPAPSIFMPAKRRQLS"
     MPAPSLLHLA TATAIRFVKD LDDLGAMPYS LARPILLNIQ NPEKLHAMEL ASPHLAEEDE        60
     ELWLELIKRD IPDWEKYHLP DNTNNWYGVY CDLRDQAQRS LDADAERMKM AIDGISAKRA       120
     LLTPKLIPER KGLRMAGSRP SFRQRHATYN HRTGGGGVEK KPSIFQPQKR NTALTMPTKS       180
     LNNRASQVKR APIGLVEEHR RPAEQAAPKP PSKAQPLPPR ISRRPGMSPP SLQHPMLAKN       240
     EARLRALTST ASAAASPRGA SSNDASGVKK SPAVATEPKP TLKRRATSPP HGAENPSASS       300
     SSRPAPCAPS SSSSSSSSSL PIPHTSSLPP SGPPSSGPPT PRPGVIRRRP APSIFMPAKR       360
     RQLS                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page