(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE462

PENCW_10.PE462       Location/Qualifiers
FT   CDS             join(1108498..1108572,1108624..1108873,1108940..1109556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129535"
FT                   /orf_name="Pc13g04620"
FT                   /product="Pc13g04620 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91531.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniParc:UPI0001830C50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B6"
FT                   /transl_table=1
FT                   /translation="MTNEPQHVTADNQFQQLITHSENDPKKLQIAYENHRSNRNALFRD
FT                   QICQPGFCEWKEDEILSKVLEAEKGLTDFVDPRNNLAFWARPPKHIRNLVYKIQQEIGP
FT                   LIGPGLWLVPPHHLHMTTLEIRSALTGPEIDEIAASLQMSGLVAELASYTLTHRARLVK
FT                   PIISYDTSAIALSFVPAAGEEDRNVYSGKDDQFTYHHLRSDLYNIVTQSGCPIAARYTV
FT                   PSAHITIARFIAPSDPKKGESDSPKEFEKEASRLIEKIEDLNHELRSNVWKRLGNPCQG
FT                   QWVIGHEKGLELMKGRTWYGVGDSIVLGEGFV"
     MTNEPQHVTA DNQFQQLITH SENDPKKLQI AYENHRSNRN ALFRDQICQP GFCEWKEDEI        60
     LSKVLEAEKG LTDFVDPRNN LAFWARPPKH IRNLVYKIQQ EIGPLIGPGL WLVPPHHLHM       120
     TTLEIRSALT GPEIDEIAAS LQMSGLVAEL ASYTLTHRAR LVKPIISYDT SAIALSFVPA       180
     AGEEDRNVYS GKDDQFTYHH LRSDLYNIVT QSGCPIAARY TVPSAHITIA RFIAPSDPKK       240
     GESDSPKEFE KEASRLIEKI EDLNHELRSN VWKRLGNPCQ GQWVIGHEKG LELMKGRTWY       300
     GVGDSIVLGE GFV                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page