(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE463

PENCW_10.PE463       Location/Qualifiers
FT   CDS             join(1110054..1110056,1110284..1110376,1110445..1110629,
FT                   1110691..1110730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672475"
FT                   /orf_name="Pc13g04630"
FT                   /product="Pc13g04630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91532.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI0001830C51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B7"
FT                   /transl_table=1
FT                   /translation="MVNIPKTRRTYCKSKDCHKHQQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKAKKQLALKRCKHFELGGDKKTKGAAL
FT                   VF"
     MVNIPKTRRT YCKSKDCHKH QQHKVTQYKA GKASLFAQGK RRYDRKQSGY GGQTKPVFHK        60
     KAKTTKKVVL RLECTACKAK KQLALKRCKH FELGGDKKTK GAALVF                      106
//

If you have problems or comments...

PBIL Back to PBIL home page