(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE465

PENCW_10.PE465       Location/Qualifiers
FT   CDS             join(complement(1115980..1116360),
FT                   complement(1115823..1115891))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672477"
FT                   /orf_name="Pc13g04650"
FT                   /product="Putative uncharacterized protein Pc13g04650 "
FT                   /protein_id="CAP91534.1"
FT                   /db_xref="UniParc:UPI0001830C53"
FT                   /db_xref="UniProtKB/TrEMBL:B6H236"
FT                   /transl_table=1
FT                   /translation="MEDEGLGYAEVKSGTITSSSEGLWREGENIFNGQELVLGNIQLPV
FT                   WKGSKRGTPRYMLWVWIAGLPVMGPYENRNENPHWLSGDINVFGVEMKSGLSKSSILQP
FT                   DSICNRRQPFFLKPHEVASIGVNPGGDNIPNTGRPMHETLLEGTG"
     MEDEGLGYAE VKSGTITSSS EGLWREGENI FNGQELVLGN IQLPVWKGSK RGTPRYMLWV        60
     WIAGLPVMGP YENRNENPHW LSGDINVFGV EMKSGLSKSS ILQPDSICNR RQPFFLKPHE       120
     VASIGVNPGG DNIPNTGRPM HETLLEGTG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page