(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE466

PENCW_10.PE466       Location/Qualifiers
FT   CDS             join(1116363..1116989,1117040..1118226,1118265..1118691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950920"
FT                   /orf_name="Pc13g04660"
FT                   /product="Pc13g04660 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91535.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H237"
FT                   /transl_table=1
FT                   /translation="MASSRSTGKRLPISCQACRTRKIRCSRDGRPCQTCVRRGLGAEDC
FT                   IYLGQPRLSTEQSSPGDSVVQSELLARIRNLEALLQKQMASNAGTPNGGAVSPLGGTSA
FT                   AGSFSEPETWDSLGPMLDNVGKLHTSPSGHVRYVPLTSQWESLVAKSCAVECLPNLDSD
FT                   IAEDDDDLQIPLARNGSISRAELLSVLPPGRYCDTLKDVYLQVFSSVFHILHDLTFEAE
FT                   YQHFCHDPGSVSTSWLALLFAILAIAVSALDDDHPLLSDLGRERTVSRNIKVLSARYRS
FT                   AALRCLAADGVMSRHSINSLQALILINYARVHRGLPIWTLLGFTHHVAISMGCHLDPER
FT                   FTLGPIEREERRRVWAGLMVLYTIQNTAFGSLDQQALPQDVKMPADIDDVDLLTSPSSK
FT                   RPAPSTFPRPTQMTYLLLNFRLYRTSSKICETIFSYPSTSRFTTSHLEAEIISVREMVE
FT                   ARYAADRNNPLLIHHQANHHILYSQIHQLLLLLLRPGLCRYLQGEITPETCATRAKCIA
FT                   SAKASLSIFETLLETQSFKPYKWYTSGLGSFHAFHAAVTLAVILLIPESQSEYEEIKDI
FT                   LDRALDMFASLSVRSVFCSKAVPIIRQMILVTNAQTSDVASTKYNPQSPTHSQSHLQAQ
FT                   AQAQAQAQVQAQVQHQQNQANIQSQSHNHLVPSIQIPPSMSNLSPGMTMQDNYALSHPH
FT                   SQSGSPVPTVASTSSEHTMHSSFGQMHPQNWISPTSVPWETLGAGTGGYGFD"
     MASSRSTGKR LPISCQACRT RKIRCSRDGR PCQTCVRRGL GAEDCIYLGQ PRLSTEQSSP        60
     GDSVVQSELL ARIRNLEALL QKQMASNAGT PNGGAVSPLG GTSAAGSFSE PETWDSLGPM       120
     LDNVGKLHTS PSGHVRYVPL TSQWESLVAK SCAVECLPNL DSDIAEDDDD LQIPLARNGS       180
     ISRAELLSVL PPGRYCDTLK DVYLQVFSSV FHILHDLTFE AEYQHFCHDP GSVSTSWLAL       240
     LFAILAIAVS ALDDDHPLLS DLGRERTVSR NIKVLSARYR SAALRCLAAD GVMSRHSINS       300
     LQALILINYA RVHRGLPIWT LLGFTHHVAI SMGCHLDPER FTLGPIEREE RRRVWAGLMV       360
     LYTIQNTAFG SLDQQALPQD VKMPADIDDV DLLTSPSSKR PAPSTFPRPT QMTYLLLNFR       420
     LYRTSSKICE TIFSYPSTSR FTTSHLEAEI ISVREMVEAR YAADRNNPLL IHHQANHHIL       480
     YSQIHQLLLL LLRPGLCRYL QGEITPETCA TRAKCIASAK ASLSIFETLL ETQSFKPYKW       540
     YTSGLGSFHA FHAAVTLAVI LLIPESQSEY EEIKDILDRA LDMFASLSVR SVFCSKAVPI       600
     IRQMILVTNA QTSDVASTKY NPQSPTHSQS HLQAQAQAQA QAQVQAQVQH QQNQANIQSQ       660
     SHNHLVPSIQ IPPSMSNLSP GMTMQDNYAL SHPHSQSGSP VPTVASTSSE HTMHSSFGQM       720
     HPQNWISPTS VPWETLGAGT GGYGFD                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page