(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE467

PENCW_10.PE467       Location/Qualifiers
FT   CDS             complement(1118990..1119589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825172"
FT                   /orf_name="Pc13g04670"
FT                   /product="Pc13g04670 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP91536.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001830C55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H238"
FT                   /transl_table=1
FT                   /translation="MSSPTELRDQPKTWTKGEYLVSTDVSLIPIETLNTWYAGEEFYWA
FT                   KPMPEPTLRETLQNSLCFGLYRNPSQVRSQNQPDKTPENEASSESTLEFVGFARCITDY
FT                   TTFLFLTDVFVLSSLQGLGLGTWLVTCVQEVIESMPYLRRSLLLTGDWKRSVPFYERVM
FT                   DMELMVCNPPVNGEDAVGFAVMQRKSWGAPGFGEKP"
     MSSPTELRDQ PKTWTKGEYL VSTDVSLIPI ETLNTWYAGE EFYWAKPMPE PTLRETLQNS        60
     LCFGLYRNPS QVRSQNQPDK TPENEASSES TLEFVGFARC ITDYTTFLFL TDVFVLSSLQ       120
     GLGLGTWLVT CVQEVIESMP YLRRSLLLTG DWKRSVPFYE RVMDMELMVC NPPVNGEDAV       180
     GFAVMQRKSW GAPGFGEKP                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page