(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE468

PENCW_10.PE468       Location/Qualifiers
FT   CDS             complement(1120093..1120983)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129536"
FT                   /orf_name="Pc13g04680"
FT                   /product="Pc13g04680 protein"
FT                   /protein_id="CAP91537.1"
FT                   /db_xref="UniParc:UPI0001830C56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H239"
FT                   /transl_table=1
FT                   /translation="MTTAAFKYIDRASYDPNATEPFKKPWGKVDGPGRSYQLIDLERKV
FT                   ENLRGQESDFTTDNSGFALYNSPAKETAFTDDAEVRAGYYAEVEDLLRKKLPGVKKVAI
FT                   FDHTIRRRTPGSARSPVQLVHVDQTPKAAEARVRRHLPEDEVEELLKGRYQIINVWRPI
FT                   ENPASDFPLALIDWRSIAPSDFVKVDLLYPKEWQEHGEVAPDPESISSTQGYEVKGETY
FT                   AIAPNEKHRFFYAKDMTPEEVMFIKCFDSRSHTMTEGKTDIAHGSGHTAFIDPQTPAGS
FT                   PGRQSIEVRCLVFYE"
     MTTAAFKYID RASYDPNATE PFKKPWGKVD GPGRSYQLID LERKVENLRG QESDFTTDNS        60
     GFALYNSPAK ETAFTDDAEV RAGYYAEVED LLRKKLPGVK KVAIFDHTIR RRTPGSARSP       120
     VQLVHVDQTP KAAEARVRRH LPEDEVEELL KGRYQIINVW RPIENPASDF PLALIDWRSI       180
     APSDFVKVDL LYPKEWQEHG EVAPDPESIS STQGYEVKGE TYAIAPNEKH RFFYAKDMTP       240
     EEVMFIKCFD SRSHTMTEGK TDIAHGSGHT AFIDPQTPAG SPGRQSIEVR CLVFYE           296
//

If you have problems or comments...

PBIL Back to PBIL home page