(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE469

PENCW_10.PE469       Location/Qualifiers
FT   CDS             join(complement(1122376..1122520),
FT                   complement(1122011..1122163),complement(1121837..1121929),
FT                   complement(1121657..1121745))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950921"
FT                   /orf_name="Pc13g04690"
FT                   /product="Putative uncharacterized protein Pc13g04690 "
FT                   /protein_id="CAP91538.1"
FT                   /db_xref="UniParc:UPI0001830D15"
FT                   /db_xref="UniProtKB/TrEMBL:B6H240"
FT                   /transl_table=1
FT                   /translation="MEFYPESIDTKSGSDQAAGSYKLTLSQGGGEQHPEMHPIGDRRIV
FT                   PIIRMLDCKRFHSVHFVPCGMPRTTTKHGVSHITTVRTKCDFHDAQHTDSIIVKVEAVI
FT                   GTNKFELDWAILLSRESDVAFGYYGSGLGVLHSMSSPLDSMRTYTRRDIKPNLIL"
     MEFYPESIDT KSGSDQAAGS YKLTLSQGGG EQHPEMHPIG DRRIVPIIRM LDCKRFHSVH        60
     FVPCGMPRTT TKHGVSHITT VRTKCDFHDA QHTDSIIVKV EAVIGTNKFE LDWAILLSRE       120
     SDVAFGYYGS GLGVLHSMSS PLDSMRTYTR RDIKPNLIL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page