(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE47

PENCW_10.PE47        Location/Qualifiers
FT   CDS             join(complement(112570..113088),complement(112413..112512),
FT                   complement(112155..112342),complement(112000..112104))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977822"
FT                   /orf_name="Pc13g00470"
FT                   /product="Pc13g00470 protein"
FT                   /protein_id="CAP91116.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830E95"
FT                   /db_xref="UniProtKB/TrEMBL:B6H185"
FT                   /transl_table=1
FT                   /translation="MDPIKRQPSRPEPEWRDGTPDWAALERTSRPSVPSSRPQPGPVII
FT                   PPTLSLPHPALQKGQIEQTIQPVFENPWLTYEAIVVISQGQSVFLARHRKDKATLVDIH
FT                   LLKQQFSSVKPLLDTISQTSHPSFLGLVGCYCWEEQVFLVREPVELSVSHILASRCTIT
FT                   EDEIAAIVRPVLGGIQYLRCHGRALAALSADTILLTELGGVRIAGVEHSCQINAAEMDA
FT                   ATMKLFALAEMVERLLMKNPSQYPWSAEIKNLPEELKRCDSPEKLLRSKLFEQLGDEGE
FT                   LKMLVNAANKTAYHNLESYKRI"
     MDPIKRQPSR PEPEWRDGTP DWAALERTSR PSVPSSRPQP GPVIIPPTLS LPHPALQKGQ        60
     IEQTIQPVFE NPWLTYEAIV VISQGQSVFL ARHRKDKATL VDIHLLKQQF SSVKPLLDTI       120
     SQTSHPSFLG LVGCYCWEEQ VFLVREPVEL SVSHILASRC TITEDEIAAI VRPVLGGIQY       180
     LRCHGRALAA LSADTILLTE LGGVRIAGVE HSCQINAAEM DAATMKLFAL AEMVERLLMK       240
     NPSQYPWSAE IKNLPEELKR CDSPEKLLRS KLFEQLGDEG ELKMLVNAAN KTAYHNLESY       300
     KRI                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page