(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE470

PENCW_10.PE470       Location/Qualifiers
FT   CDS             join(1122695..1123255,1123320..1124129)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950922"
FT                   /orf_name="Pc13g04700"
FT                   /product="Pc13g04700 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP91539.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0001830D16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H241"
FT                   /transl_table=1
FT                   /translation="MKFSALLGLLTFAAAVSADIKDQQSPLSSPSIANLKSKIKNVVIL
FT                   EMENRSVDNLLGGQTIKGLDNPINNGPFCNPYNLTDPSAGTVCSSAKDFDSVLDDPDHS
FT                   VTGNNIEFYGSFVPNNAHIAQGKLTPTQHGFVHEQLRSYGDDADKAYLAKQVINYYIED
FT                   EVPVMTTLVQNYLAFNHWHSDHPGPTNPNRAFVLSGTSAGHGYNDETFNPDIHGLTHRS
FT                   IFQQLSETNHTWKNYYTSPSMVDAYFFNWTFTSGNSDKAVPLDNFYADAAAGTLPEFSF
FT                   VDPSCCGVGTNSMHPTGLVSEGEALIKDVYDAVRSSPQWEETLLILTFDETGGFHDHVP
FT                   PPLATRPDDLTYTEIAPSGEKYTFSFDRLGGRVPTLLISPWVAKGQVEQKGTNSDGKVV
FT                   SYSASSILRTLGYLWDFEPFTPRVKSSPSFEHLIHNTARTDTPVKLPVPKAFRKMEI"
     MKFSALLGLL TFAAAVSADI KDQQSPLSSP SIANLKSKIK NVVILEMENR SVDNLLGGQT        60
     IKGLDNPINN GPFCNPYNLT DPSAGTVCSS AKDFDSVLDD PDHSVTGNNI EFYGSFVPNN       120
     AHIAQGKLTP TQHGFVHEQL RSYGDDADKA YLAKQVINYY IEDEVPVMTT LVQNYLAFNH       180
     WHSDHPGPTN PNRAFVLSGT SAGHGYNDET FNPDIHGLTH RSIFQQLSET NHTWKNYYTS       240
     PSMVDAYFFN WTFTSGNSDK AVPLDNFYAD AAAGTLPEFS FVDPSCCGVG TNSMHPTGLV       300
     SEGEALIKDV YDAVRSSPQW EETLLILTFD ETGGFHDHVP PPLATRPDDL TYTEIAPSGE       360
     KYTFSFDRLG GRVPTLLISP WVAKGQVEQK GTNSDGKVVS YSASSILRTL GYLWDFEPFT       420
     PRVKSSPSFE HLIHNTARTD TPVKLPVPKA FRKMEI                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page