(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE472

PENCW_10.PE472       Location/Qualifiers
FT   CDS             complement(1129952..1132675)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951945"
FT                   /orf_name="Pc13g04720"
FT                   /product="Pc13g04720 protein"
FT                   /protein_id="CAP91541.1"
FT                   /db_xref="UniParc:UPI0001830D18"
FT                   /db_xref="UniProtKB/TrEMBL:B6H243"
FT                   /transl_table=1
FT                   /translation="MAAESERPPHLNGTPGRSSGPKGAEAPSDPTHRSASESGMMERSL
FT                   VTPQTQPMSQVPKLFPTPPSASASASTTNSAVSSREPSPVRHSSRTYTPTYNPSSPTRV
FT                   SSQSRKTSQDRSSPIRHSNGLTSGPPTSSPTPNLQRSSSSPVRSLGLSVPVDSPANVPG
FT                   PEKSNMPSWAANRRTDLDSTLPNTSQKRSSLPLEDFTPKPDRNTTRTVARGVSGQGSSL
FT                   ETVEEMASNPSTPSSETPTKPVIPEESRLHRIDEDPTPRAPHQTLGSGSDSGENRSSEP
FT                   KEETRPQAPSAAKTTKTLMSQRSTTSLSASARGKPADGSVRNMIVETETVSSIPQVSMG
FT                   VGNGERGNASRAEQGTLRMKPSNETIRPRKEKKKNRRPNALLTTGPVTSKADIFEARVA
FT                   NAVDEADVSDSDETFVYDSNPPDPYPSRPPRYHSRTPSATSMASQAEQLAGRTRGLRDT
FT                   SHGVTGKRSMKFTNTNPYNNGSIEGDGVEIDMASRSTRPDGSGTITPRHHNLGRLHGRN
FT                   GMHPNLFDNDSAHSQSQSQKSPRHFIGNSYRHSRHRLSPNYRTIGGSKKSGEYDYEAEG
FT                   ADDERTPLVGTPRTMHSRGGRRPNSASLRQMQYMAQRERGVFARFGSCAIIFLLLLIVA
FT                   GGATSFIVAATQPLLDVQVIAIQNVLASEQEIMLDLNVQAINPNLFPVTIDDTDVNIFA
FT                   KSRYVGTDKFWREHGDLDNFPRVEQSRRRWQLSQAVRCLGNMDCVKEAMSSQPDPHTTD
FT                   GVDKGTDPPTDPEGDPRSMLLGRVFHFDSPLSFESSPWNHLTSSSKGQIRLPRPGNKTE
FT                   AGGTERWERVLQHPFELTVRGIIKYQLPLSSRYLSASVSSSIKVVPDTDDNDPEQTPPS
FT                   NDTVRISVPQRSAPPIRLPLDTRSTGSGDSRRPFTA"
     MAAESERPPH LNGTPGRSSG PKGAEAPSDP THRSASESGM MERSLVTPQT QPMSQVPKLF        60
     PTPPSASASA STTNSAVSSR EPSPVRHSSR TYTPTYNPSS PTRVSSQSRK TSQDRSSPIR       120
     HSNGLTSGPP TSSPTPNLQR SSSSPVRSLG LSVPVDSPAN VPGPEKSNMP SWAANRRTDL       180
     DSTLPNTSQK RSSLPLEDFT PKPDRNTTRT VARGVSGQGS SLETVEEMAS NPSTPSSETP       240
     TKPVIPEESR LHRIDEDPTP RAPHQTLGSG SDSGENRSSE PKEETRPQAP SAAKTTKTLM       300
     SQRSTTSLSA SARGKPADGS VRNMIVETET VSSIPQVSMG VGNGERGNAS RAEQGTLRMK       360
     PSNETIRPRK EKKKNRRPNA LLTTGPVTSK ADIFEARVAN AVDEADVSDS DETFVYDSNP       420
     PDPYPSRPPR YHSRTPSATS MASQAEQLAG RTRGLRDTSH GVTGKRSMKF TNTNPYNNGS       480
     IEGDGVEIDM ASRSTRPDGS GTITPRHHNL GRLHGRNGMH PNLFDNDSAH SQSQSQKSPR       540
     HFIGNSYRHS RHRLSPNYRT IGGSKKSGEY DYEAEGADDE RTPLVGTPRT MHSRGGRRPN       600
     SASLRQMQYM AQRERGVFAR FGSCAIIFLL LLIVAGGATS FIVAATQPLL DVQVIAIQNV       660
     LASEQEIMLD LNVQAINPNL FPVTIDDTDV NIFAKSRYVG TDKFWREHGD LDNFPRVEQS       720
     RRRWQLSQAV RCLGNMDCVK EAMSSQPDPH TTDGVDKGTD PPTDPEGDPR SMLLGRVFHF       780
     DSPLSFESSP WNHLTSSSKG QIRLPRPGNK TEAGGTERWE RVLQHPFELT VRGIIKYQLP       840
     LSSRYLSASV SSSIKVVPDT DDNDPEQTPP SNDTVRISVP QRSAPPIRLP LDTRSTGSGD       900
     SRRPFTA                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page