(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE473

PENCW_10.PE473       Location/Qualifiers
FT   CDS             join(complement(1134388..1134430),
FT                   complement(1133616..1134346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978593"
FT                   /orf_name="Pc13g04730"
FT                   /product="Pc13g04730 protein"
FT                   /protein_id="CAP91542.1"
FT                   /db_xref="UniParc:UPI0001830D19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H244"
FT                   /transl_table=1
FT                   /translation="MTMVAWRVYLFQSGDLESGRRERETDYMLFHIDPVDFTHDFLDEA
FT                   TAYFPRLRLSFDIPHKLLLITIPSPEHAAAIGALSEETRRDLDSMGHGLSHAIKSYPGG
FT                   GTRAQNGKGKDADIAFGPRRRAVGERANGNEKRYTVVAEIAISETETKLKRDTDFWLDP
FT                   LCGNANLVITITASRKLAYIKIDTWQRVNDQAHCTGSLSITKTTQGRVKVTGPLRIPFD
FT                   ALFDRAPTSPAERAISLSVQRLQSLAEAIWEDQGI"
     MTMVAWRVYL FQSGDLESGR RERETDYMLF HIDPVDFTHD FLDEATAYFP RLRLSFDIPH        60
     KLLLITIPSP EHAAAIGALS EETRRDLDSM GHGLSHAIKS YPGGGTRAQN GKGKDADIAF       120
     GPRRRAVGER ANGNEKRYTV VAEIAISETE TKLKRDTDFW LDPLCGNANL VITITASRKL       180
     AYIKIDTWQR VNDQAHCTGS LSITKTTQGR VKVTGPLRIP FDALFDRAPT SPAERAISLS       240
     VQRLQSLAEA IWEDQGI                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page