(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE474

PENCW_10.PE474       Location/Qualifiers
FT   CDS             join(complement(1136079..1136762),
FT                   complement(1135956..1136030),complement(1135556..1135900))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672737"
FT                   /orf_name="Pc13g04740"
FT                   /product="Putative uncharacterized protein Pc13g04740 "
FT                   /protein_id="CAP91543.1"
FT                   /db_xref="UniParc:UPI0001830D1A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C3"
FT                   /transl_table=1
FT                   /translation="MDAAEEYAELMNVNKNEGKYLFYPQRFSRLHPGSVGFFNRHGVWS
FT                   EITDLCEEGRPKRDGYENPSRPLKLDQPTESFWKTRSSGSEAEMNFGLTGGLSGALSAA
FT                   PVDVSAEAKNKSGSSGQAALITESAVRHETLEAPFQGPIQKWVEKNAKALVDSDYGEDV
FT                   ATYGLWAIQAAWVTKECAITLNSAKNREANLGFDVGATGLGKVGASGGSLAKLEQKGWT
FT                   AYEAKEGDQGLVIAFGGFKYELHKFFKWRSNPLKITDTRMDERPETIQVTPLFTKPILD
FT                   ENGVETGFEIFKHILNENGEKIGEEKVDIGVQGKEGEGNERRDAEREKEEQERQEKPEE
FT                   KEDSMIQCDTVGISETALEADSKAKQA"
     MDAAEEYAEL MNVNKNEGKY LFYPQRFSRL HPGSVGFFNR HGVWSEITDL CEEGRPKRDG        60
     YENPSRPLKL DQPTESFWKT RSSGSEAEMN FGLTGGLSGA LSAAPVDVSA EAKNKSGSSG       120
     QAALITESAV RHETLEAPFQ GPIQKWVEKN AKALVDSDYG EDVATYGLWA IQAAWVTKEC       180
     AITLNSAKNR EANLGFDVGA TGLGKVGASG GSLAKLEQKG WTAYEAKEGD QGLVIAFGGF       240
     KYELHKFFKW RSNPLKITDT RMDERPETIQ VTPLFTKPIL DENGVETGFE IFKHILNENG       300
     EKIGEEKVDI GVQGKEGEGN ERRDAEREKE EQERQEKPEE KEDSMIQCDT VGISETALEA       360
     DSKAKQA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page