(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE475

PENCW_10.PE475       Location/Qualifiers
FT   CDS             join(complement(1140390..1140868),
FT                   complement(1138261..1140321),complement(1137982..1138184),
FT                   complement(1137862..1137932))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951946"
FT                   /orf_name="Pc13g04750"
FT                   /product="Pc13g04750 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91544.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001830D1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C4"
FT                   /transl_table=1
FT                   /translation="MDPPMIPIPGTASSRPPRSSHSSSPRKRPQHSDYPPADNNASHGL
FT                   MSGGRAPGTGPVPVPETSPANKTRSNPPADNAAGKPSKSSKRKKNRNRKRRNRHQSFIP
FT                   PSREESHDSPTEISDAGGVRDSMEADRPTSRDKSFFKLGRNLSNTSLESDALLDHRDQP
FT                   SMRPRRDSRLASSFRPSSLTSNVFRSNDGQSRNTPRGTRSQQHNGDSDEEDTNDRTPLM
FT                   RPVSGQIPGHNRYGTDTRPGLFSSRARHPSAQTISSECSPKDDRSPLYSPCVDRDYDVN
FT                   NPPSIPGSPKLGPEMNYEDAVVTGADWDFSMARSLDNRKDSLNPLNDTLIDIEGNGSHP
FT                   HSAPSSSPGSPLLSPHQELRRRRTVAVPAEEDVCFPTEAISELGDEGPRQMRDEVGERR
FT                   RRRHRRWPDLSVLEEWSREEKEERNGDIRVKRISEPVLVEGRLRPQYTGWRREEDEAPY
FT                   RFTYFNEEFPSTIHAQTISELVQPGGSFRDLFIPDPPELEDSSEDEDDEDESFVENPAF
FT                   NNSTQAPNKPTYHSDNQSQGQGHQTNVNPHMTTQTVAPNGRSTSDLMTGNAPPVRGPSR
FT                   LSVISEGRPDSHRELSPAPSNTPFNNTPNTKPKRYGPRPTFWLDVLSPTDGEMRTIAKA
FT                   FGIHALTAEDIMMQEAREKVELFRSYYFVNYRTFEQDVNSEDYLEPVNMYVVVFREGVI
FT                   SFHFSQTPHPANVRRRIRQLMDYLILSSDWISYALIDDITDVFGPLIQAIEDEVDEIDE
FT                   MIMQMHSSSKEVSSNDSVLPSFAPGEMLRRVGECRKKVMGLYRLLSNKADVVKGFAKRC
FT                   NEQWEVAPKSEIGLYLGDIQDHIMTMTGNLTHYETILSRAHSNYLAQINILMNERQEHT
FT                   ADVLGKLTVLGTIVLPMNIICGMWGMNVKVPGQDIDSLTWFWCITAGLCVFAFVSVWTA
FT                   KRVYKIV"
     MDPPMIPIPG TASSRPPRSS HSSSPRKRPQ HSDYPPADNN ASHGLMSGGR APGTGPVPVP        60
     ETSPANKTRS NPPADNAAGK PSKSSKRKKN RNRKRRNRHQ SFIPPSREES HDSPTEISDA       120
     GGVRDSMEAD RPTSRDKSFF KLGRNLSNTS LESDALLDHR DQPSMRPRRD SRLASSFRPS       180
     SLTSNVFRSN DGQSRNTPRG TRSQQHNGDS DEEDTNDRTP LMRPVSGQIP GHNRYGTDTR       240
     PGLFSSRARH PSAQTISSEC SPKDDRSPLY SPCVDRDYDV NNPPSIPGSP KLGPEMNYED       300
     AVVTGADWDF SMARSLDNRK DSLNPLNDTL IDIEGNGSHP HSAPSSSPGS PLLSPHQELR       360
     RRRTVAVPAE EDVCFPTEAI SELGDEGPRQ MRDEVGERRR RRHRRWPDLS VLEEWSREEK       420
     EERNGDIRVK RISEPVLVEG RLRPQYTGWR REEDEAPYRF TYFNEEFPST IHAQTISELV       480
     QPGGSFRDLF IPDPPELEDS SEDEDDEDES FVENPAFNNS TQAPNKPTYH SDNQSQGQGH       540
     QTNVNPHMTT QTVAPNGRST SDLMTGNAPP VRGPSRLSVI SEGRPDSHRE LSPAPSNTPF       600
     NNTPNTKPKR YGPRPTFWLD VLSPTDGEMR TIAKAFGIHA LTAEDIMMQE AREKVELFRS       660
     YYFVNYRTFE QDVNSEDYLE PVNMYVVVFR EGVISFHFSQ TPHPANVRRR IRQLMDYLIL       720
     SSDWISYALI DDITDVFGPL IQAIEDEVDE IDEMIMQMHS SSKEVSSNDS VLPSFAPGEM       780
     LRRVGECRKK VMGLYRLLSN KADVVKGFAK RCNEQWEVAP KSEIGLYLGD IQDHIMTMTG       840
     NLTHYETILS RAHSNYLAQI NILMNERQEH TADVLGKLTV LGTIVLPMNI ICGMWGMNVK       900
     VPGQDIDSLT WFWCITAGLC VFAFVSVWTA KRVYKIV                                937
//

If you have problems or comments...

PBIL Back to PBIL home page