(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE476

PENCW_10.PE476       Location/Qualifiers
FT   CDS             join(1141701..1141788,1141865..1142616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000059368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951947"
FT                   /orf_name="Pc13g04760"
FT                   /product="Pc13g04760 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91545.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830D1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C5"
FT                   /transl_table=1
FT                   /translation="MAPPTCRSEILAHLRRQIEDGKPIVGAGAGIGLSAKSVEAGGADL
FT                   VIIYNSGRFRMAGCGSLAGLMPYSNANEVVVEMAAEVIPIVQNIPVIAGVCGTDPFKHI
FT                   PRFLKQLRDLGFAGVQNFPTVGLIDGNFRANLEETGMGYGKEVEMVRQAAELDILTTPY
FT                   VFNVEEAEAMTKAGADILVAHMGLTTSGLIGAKTGKTLDQCVVEIQAMRDAAVQINKDV
FT                   IVLCHGGPIAAPEDAKFVLDRVQGLHGFYGASSMERLPVEVAIRDTTAEFKKIALKR"
     MAPPTCRSEI LAHLRRQIED GKPIVGAGAG IGLSAKSVEA GGADLVIIYN SGRFRMAGCG        60
     SLAGLMPYSN ANEVVVEMAA EVIPIVQNIP VIAGVCGTDP FKHIPRFLKQ LRDLGFAGVQ       120
     NFPTVGLIDG NFRANLEETG MGYGKEVEMV RQAAELDILT TPYVFNVEEA EAMTKAGADI       180
     LVAHMGLTTS GLIGAKTGKT LDQCVVEIQA MRDAAVQINK DVIVLCHGGP IAAPEDAKFV       240
     LDRVQGLHGF YGASSMERLP VEVAIRDTTA EFKKIALKR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page