(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE478

PENCW_10.PE478       Location/Qualifiers
FT   CDS             complement(1144707..1146188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951948"
FT                   /orf_name="Pc13g04780"
FT                   /product="Pc13g04780 protein"
FT                   /protein_id="CAP91547.1"
FT                   /db_xref="UniParc:UPI0001830D1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C7"
FT                   /transl_table=1
FT                   /translation="MQHLQDIETRLDQLISENRLLIAARDEAEDKLRNTTVARRKSDRA
FT                   LNTRDGDLRDRESEVEQLKNSVEWLQKEISRLTQENEGLTASNSALAAAHAAEVNSVRE
FT                   SSTRELADLQSQHNQLSSQIEDRVRQEIESALAQKDIELRRLRTELEEARDKVKELQQQ
FT                   IAASVHDNALVFRDEEYFDAACQKLCGHVQSWVVRFSKHNDKRRCRPLSELQDEKIADR
FT                   FDNALLDGSDPDAYLSDRVRRRDVFMSVVMTMVWEYIFTRYLFGMDREQRQKLKSLEKQ
FT                   LGEVGPARAVHRWRATTLTLLSRRPAFAAQRESDTEAVTLEIFQTLSRILPPPSHVESQ
FT                   LLDNLRKIMRVAVNLSLEMRTQLAEFIMLPPLQPEYDTNGDLARQVYFNAALMNERSGL
FT                   TNDNGELEAQQSIVRIVLFPLVVKKGNDVGEGDDEVVVCPAQVLVARPSKDKKVSRMMS
FT                   GDRMSIDPTRSVHSIVQSITHSVAPSSMMDMSNVI"
     MQHLQDIETR LDQLISENRL LIAARDEAED KLRNTTVARR KSDRALNTRD GDLRDRESEV        60
     EQLKNSVEWL QKEISRLTQE NEGLTASNSA LAAAHAAEVN SVRESSTREL ADLQSQHNQL       120
     SSQIEDRVRQ EIESALAQKD IELRRLRTEL EEARDKVKEL QQQIAASVHD NALVFRDEEY       180
     FDAACQKLCG HVQSWVVRFS KHNDKRRCRP LSELQDEKIA DRFDNALLDG SDPDAYLSDR       240
     VRRRDVFMSV VMTMVWEYIF TRYLFGMDRE QRQKLKSLEK QLGEVGPARA VHRWRATTLT       300
     LLSRRPAFAA QRESDTEAVT LEIFQTLSRI LPPPSHVESQ LLDNLRKIMR VAVNLSLEMR       360
     TQLAEFIMLP PLQPEYDTNG DLARQVYFNA ALMNERSGLT NDNGELEAQQ SIVRIVLFPL       420
     VVKKGNDVGE GDDEVVVCPA QVLVARPSKD KKVSRMMSGD RMSIDPTRSV HSIVQSITHS       480
     VAPSSMMDMS NVI                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page