(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE479

PENCW_10.PE479       Location/Qualifiers
FT   CDS             join(complement(1157781..1157834),
FT                   complement(1150344..1157748),complement(1148703..1150172),
FT                   complement(1146334..1148429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825424"
FT                   /orf_name="Pc13g04790"
FT                   /product="Pc13g04790 protein"
FT                   /protein_id="CAP91548.1"
FT                   /db_xref="UniParc:UPI0001830DD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C8"
FT                   /transl_table=1
FT                   /translation="MVLLHGFQHPRLAQLLLQRPRSQSTSPPATEKTLDLTPKSLSRPA
FT                   SPETSHPQGSRSPKQRRHSVAKSTTESPTAVPLHFRRPPTSPGLSRAVPVEQPAPIASP
FT                   GSPSQQRNRRPGSVEFRNSREIRPLWLVERHSLTKGEPETEEPLPSLPSSKTSSRVPSI
FT                   EDLKSLRDDDGLKSWEHVDLSHSITGNQRPTGLTISTEQANESHSGDVDLLGSQQATPT
FT                   AEHFQDAESRKERPRYEFHSPSELLRDPTALDELPPSPTLDALPSAEGSLVGVGSREQE
FT                   TQRALDALEGVSRPQSESETPTQDNNSLSSAAAEFAKGAGFAGVVDAVAIAAAREHDQS
FT                   RALPGDELAKPRSFGDIVDAAVAADGSSHDHDKAPVHEEALSEPVTAIEETAPAPLEPV
FT                   HPEMETAKESVPESTEQPVQSSDRQAQPETEVAPDESAQSSKKKNKKKKGKKNQAQDVE
FT                   LGGPEEPLAQEELSKEPVEEPAMDTPTVETVSAEPEVSVPEQSEPVEASRELGPGTGAD
FT                   EPVVEGAPVESAPVESAPIEPEVANPEQLEAEPIEASREVEIEPSVEAAQEPGVVTAPE
FT                   AESTEVPPAETELAEDAASSTKKAKRDKKKQKKKSKNESTSEEPTDDNVVAQPQDDTSA
FT                   SKEIEGQQEDSAHAPSEEIVATPLPEEMVTSTESTESTPDQTATSSAAIDAEQARSHPE
FT                   SGELVEPVEQVSTEEPVLPVSEGPSVPIELTPEPAFTDANETPITSATQPEAEEVSRSL
FT                   EQIEKPSEESTPEAPLDNTTPEITETPKEDTEGEDNFEEAVEEQIPQPAEEKEPPVEEP
FT                   PVEVATDAPAEASETKAEKRKNKKKKNRKSTAVEETDISTEMPAPETELPPERKEPEPE
FT                   QSAVVEPADTQSLPIGGEALPSDPEHLEQPTKDVDQPIETTIEESAATQEQEQAPLEAA
FT                   VDATPAVTEPVDPAGPSDELSQPAVVEVQPDAKLPAEEASREIPEPSAVETQPEAEVQA
FT                   EPQPEVAAEPEVALTAAQKKKAKKNKKKGKQSDSSIPDEKPAESTSPAPEAETAAEEIA
FT                   KETLLATEDTPVVAPPQESEMEVPVKVEQSIEPEQLPETEQIPEDLPALDEASPEPLPE
FT                   PMAEVTETQTTKEESNAPGEEPKAEESPAEPEVPMTAAERKRAKKAKKKQQKEQEESIG
FT                   SIAEDTKPVETVPAPDAESAEPSKDIAPAAEIDNVAPADSSAPVSSEPAETEQDVAPTS
FT                   TTEPEAAPVTEDTPLPTDPESIEPTKGIEAPAKAEPPVKDAAPSPEIGATEVAADVPLV
FT                   SEEAAAPVDVPQDLDQHNDVVKAEEPKSEDLTPAPTQEASADAPETDAPKAQEQSPEPE
FT                   VLMTAAERKKAKKNKKKQQKQEAVQLDEQPTREAEPTSAEEKSVEQSGDMLPESEPTPT
FT                   AETAAGVDDPTEPEAASDLEAETKPEEEQLQDVAKLDSEVVPGAPADEAISTPETAEQA
FT                   IDVQDGNKETAPEPTVEVPASTEDPQEAQKLDSAISEELALEKSLDDKPTESTSEPVAE
FT                   ETQPTESASPVVEQVEDEQAATSSKSKKKNKKKKRQSVAADEEQPAPAEEEVKPAPTEE
FT                   EPTPVPAENEPTEPAPSQELEQPSSGKDADTPMVTEEAPKAGEPVMDETTQPEAPADTA
FT                   ATEAAAEAAMTPAQKRKAKKDKKKRQSVAVQEEQPAAAEEESKAAPVGEEVKAAPEEEP
FT                   TPVPAENKHTESSSQDLEQPSPEKDAETPIVMEEAPKAEETTQPEAPADAAATETVEEA
FT                   AMTPAQKKKAKKDKKKRQSVIAEQEQPASVDEPKPELAEEKATPTPAEEDPTPESGQEE
FT                   LVEPTPTQEIEQSAVEKDVESPIMTEEAPKAEEIMQPEAPANAAATEALEEAAMTPAQK
FT                   KKAKKDKKKRQSVIAEEEQPASVDEPKPESAQEEPAKAESTRDTEHSTVDKDAQAPVMA
FT                   EEAPKAEEPSPEEATQPEGPADAAATEAAVETPAEEAMTPAQKRKAKKDKKKRQSVITE
FT                   EEQPTPVEEPTPESVQEKPTEPESTQEIEQPTLDEAAQTPIITEEEAPKVEEPSLENVT
FT                   PQDAPADAAATEPATEETMTPAQKKKAKKDKKKQQKSVAFDENATLTEDPKPEQDTSTP
FT                   EEKVESRDAPADLIVSEESAKELPVTEEAAEPAPEADISETREEPASSEESKDTTEHEP
FT                   TSTTAPDTPVPSEVKEPESAAALPEHPEQDAQTPPEFQNPSAQEPEVALTAAQRKKAKK
FT                   NKKKGKSVDLADNAPSATDAVQESEPKSEPVVQTSTDTPAETPELQDTPASELALPAEG
FT                   LEQDNTIEPEAPKAEEHETTEAVSDDVTKEETPEAKKTDNEPPATETILDAEPAPSQEV
FT                   EAVASSPTEPTEEAGMSAKERRKAAKKAKKRQSKNVDADTDAATSDPPSAPATEPTAPI
FT                   EAADSVEKVLTSTDTDAPGLSAVPASSPAEHDGKEHQSHGIETYDATAQDTTSTDKDMS
FT                   SQVEQTPIESPFLDYPPQPVLERDLSTEKEIEEMPVDVPIDVVPEAQIQESPVEEKASE
FT                   AAVSKKHKKKNKNKNKDIKQEEEAAVPEPASSTAEDKEQSEAGPSVEAEIQPEVKEIIE
FT                   PEPIAVAESVPIPEEQQPDQLQDIEETAAVQTTEDVDDTKEINVPEAEAAAPPTEDTTQ
FT                   PEAPVDVADIEATEDASMTPAQKRKAKKDKKKQRQSIIAQEPEAEAQPEEKTAPEAAET
FT                   SAQEAGITTEAAPGEIVTQDEAVPSAEEPTAQPIDAIQEAAKDPVTPSEDTEQHVLSQE
FT                   IENGERSLELPSTESKVEEGDKPTEQAAAAPAENPDDEQSSKKGLPEAGPEPEGESATV
FT                   PKKMSKKEKKKAAAAAAAAALVKEEKLAESQPEPKEALVSTPQAPEEVVDQSMVQEPQS
FT                   SETEDKPPPEAEKNPDEITGLPASRLKEDVLEQPAEALDSTEPLESEVKLEESTKELAE
FT                   EPAAAETITRKMSKKDKKRAKKQAQEEIIEPTSPPTEDHAQSEKNEAVISLGTLDTPSP
FT                   VEPTDQNTNNEPLDLERPAEKNDKKDEALVVADSQNLENAAVDQPVQPEVMPAMSKKMS
FT                   KKDKRKVKKNAGITEEVLAQQQEPQADVAELPTESEVQPAEPAAEKEIHQEPEHSAEAQ
FT                   PSLERELPIETPASIENEPIPDPGVQVKPTQPDEEPVVSEEVPLSRKASKKKAKKAQKA
FT                   NKSLDAEALAENTIADHHTTIVPFEEDQSKAEGLEVPDEKSAQDEEDWPAIDWQAKFEE
FT                   SQRSREADPEPEPDIPAPEPEIIGEFVDSSFREVSQDANEATEEDAWALPTSKKDKKKA
FT                   KKNKKQSQQTPPEAEGPSLEPFNDIEIEPPARTTTPGGSKIANLFPGLERGGFRRSALD
FT                   QQPRSLKDSAEEETTADLEANRDVAIPVLEAPPATTETKEIPRDFTSELPSSLERQIES
FT                   TISELKAHSETPTATEHGSIREPELPPEGDKSKDMPSSLSMEPSDERTRPTEPSSPTRL
FT                   PPREEAGKELCELRRSPSIHGRHQHTPRTWSLEEPSLPALRAPSPPRSLFGGPTDDYVR
FT                   PRTPLDTIAEQEPRDGQGATMARRGTPRLEMKPEHVLPRPQTPVRKFTDNAFDREAWPK
FT                   ENKKGEGFKPEILKTPEQGMPILKPSTSSGKLRRTNRSISGDLRAASRALDSQPSNLDL
FT                   DQLPSSSSYDPVTDKGKRPLRNMSDVYVSH"
     MVLLHGFQHP RLAQLLLQRP RSQSTSPPAT EKTLDLTPKS LSRPASPETS HPQGSRSPKQ        60
     RRHSVAKSTT ESPTAVPLHF RRPPTSPGLS RAVPVEQPAP IASPGSPSQQ RNRRPGSVEF       120
     RNSREIRPLW LVERHSLTKG EPETEEPLPS LPSSKTSSRV PSIEDLKSLR DDDGLKSWEH       180
     VDLSHSITGN QRPTGLTIST EQANESHSGD VDLLGSQQAT PTAEHFQDAE SRKERPRYEF       240
     HSPSELLRDP TALDELPPSP TLDALPSAEG SLVGVGSREQ ETQRALDALE GVSRPQSESE       300
     TPTQDNNSLS SAAAEFAKGA GFAGVVDAVA IAAAREHDQS RALPGDELAK PRSFGDIVDA       360
     AVAADGSSHD HDKAPVHEEA LSEPVTAIEE TAPAPLEPVH PEMETAKESV PESTEQPVQS       420
     SDRQAQPETE VAPDESAQSS KKKNKKKKGK KNQAQDVELG GPEEPLAQEE LSKEPVEEPA       480
     MDTPTVETVS AEPEVSVPEQ SEPVEASREL GPGTGADEPV VEGAPVESAP VESAPIEPEV       540
     ANPEQLEAEP IEASREVEIE PSVEAAQEPG VVTAPEAEST EVPPAETELA EDAASSTKKA       600
     KRDKKKQKKK SKNESTSEEP TDDNVVAQPQ DDTSASKEIE GQQEDSAHAP SEEIVATPLP       660
     EEMVTSTEST ESTPDQTATS SAAIDAEQAR SHPESGELVE PVEQVSTEEP VLPVSEGPSV       720
     PIELTPEPAF TDANETPITS ATQPEAEEVS RSLEQIEKPS EESTPEAPLD NTTPEITETP       780
     KEDTEGEDNF EEAVEEQIPQ PAEEKEPPVE EPPVEVATDA PAEASETKAE KRKNKKKKNR       840
     KSTAVEETDI STEMPAPETE LPPERKEPEP EQSAVVEPAD TQSLPIGGEA LPSDPEHLEQ       900
     PTKDVDQPIE TTIEESAATQ EQEQAPLEAA VDATPAVTEP VDPAGPSDEL SQPAVVEVQP       960
     DAKLPAEEAS REIPEPSAVE TQPEAEVQAE PQPEVAAEPE VALTAAQKKK AKKNKKKGKQ      1020
     SDSSIPDEKP AESTSPAPEA ETAAEEIAKE TLLATEDTPV VAPPQESEME VPVKVEQSIE      1080
     PEQLPETEQI PEDLPALDEA SPEPLPEPMA EVTETQTTKE ESNAPGEEPK AEESPAEPEV      1140
     PMTAAERKRA KKAKKKQQKE QEESIGSIAE DTKPVETVPA PDAESAEPSK DIAPAAEIDN      1200
     VAPADSSAPV SSEPAETEQD VAPTSTTEPE AAPVTEDTPL PTDPESIEPT KGIEAPAKAE      1260
     PPVKDAAPSP EIGATEVAAD VPLVSEEAAA PVDVPQDLDQ HNDVVKAEEP KSEDLTPAPT      1320
     QEASADAPET DAPKAQEQSP EPEVLMTAAE RKKAKKNKKK QQKQEAVQLD EQPTREAEPT      1380
     SAEEKSVEQS GDMLPESEPT PTAETAAGVD DPTEPEAASD LEAETKPEEE QLQDVAKLDS      1440
     EVVPGAPADE AISTPETAEQ AIDVQDGNKE TAPEPTVEVP ASTEDPQEAQ KLDSAISEEL      1500
     ALEKSLDDKP TESTSEPVAE ETQPTESASP VVEQVEDEQA ATSSKSKKKN KKKKRQSVAA      1560
     DEEQPAPAEE EVKPAPTEEE PTPVPAENEP TEPAPSQELE QPSSGKDADT PMVTEEAPKA      1620
     GEPVMDETTQ PEAPADTAAT EAAAEAAMTP AQKRKAKKDK KKRQSVAVQE EQPAAAEEES      1680
     KAAPVGEEVK AAPEEEPTPV PAENKHTESS SQDLEQPSPE KDAETPIVME EAPKAEETTQ      1740
     PEAPADAAAT ETVEEAAMTP AQKKKAKKDK KKRQSVIAEQ EQPASVDEPK PELAEEKATP      1800
     TPAEEDPTPE SGQEELVEPT PTQEIEQSAV EKDVESPIMT EEAPKAEEIM QPEAPANAAA      1860
     TEALEEAAMT PAQKKKAKKD KKKRQSVIAE EEQPASVDEP KPESAQEEPA KAESTRDTEH      1920
     STVDKDAQAP VMAEEAPKAE EPSPEEATQP EGPADAAATE AAVETPAEEA MTPAQKRKAK      1980
     KDKKKRQSVI TEEEQPTPVE EPTPESVQEK PTEPESTQEI EQPTLDEAAQ TPIITEEEAP      2040
     KVEEPSLENV TPQDAPADAA ATEPATEETM TPAQKKKAKK DKKKQQKSVA FDENATLTED      2100
     PKPEQDTSTP EEKVESRDAP ADLIVSEESA KELPVTEEAA EPAPEADISE TREEPASSEE      2160
     SKDTTEHEPT STTAPDTPVP SEVKEPESAA ALPEHPEQDA QTPPEFQNPS AQEPEVALTA      2220
     AQRKKAKKNK KKGKSVDLAD NAPSATDAVQ ESEPKSEPVV QTSTDTPAET PELQDTPASE      2280
     LALPAEGLEQ DNTIEPEAPK AEEHETTEAV SDDVTKEETP EAKKTDNEPP ATETILDAEP      2340
     APSQEVEAVA SSPTEPTEEA GMSAKERRKA AKKAKKRQSK NVDADTDAAT SDPPSAPATE      2400
     PTAPIEAADS VEKVLTSTDT DAPGLSAVPA SSPAEHDGKE HQSHGIETYD ATAQDTTSTD      2460
     KDMSSQVEQT PIESPFLDYP PQPVLERDLS TEKEIEEMPV DVPIDVVPEA QIQESPVEEK      2520
     ASEAAVSKKH KKKNKNKNKD IKQEEEAAVP EPASSTAEDK EQSEAGPSVE AEIQPEVKEI      2580
     IEPEPIAVAE SVPIPEEQQP DQLQDIEETA AVQTTEDVDD TKEINVPEAE AAAPPTEDTT      2640
     QPEAPVDVAD IEATEDASMT PAQKRKAKKD KKKQRQSIIA QEPEAEAQPE EKTAPEAAET      2700
     SAQEAGITTE AAPGEIVTQD EAVPSAEEPT AQPIDAIQEA AKDPVTPSED TEQHVLSQEI      2760
     ENGERSLELP STESKVEEGD KPTEQAAAAP AENPDDEQSS KKGLPEAGPE PEGESATVPK      2820
     KMSKKEKKKA AAAAAAAALV KEEKLAESQP EPKEALVSTP QAPEEVVDQS MVQEPQSSET      2880
     EDKPPPEAEK NPDEITGLPA SRLKEDVLEQ PAEALDSTEP LESEVKLEES TKELAEEPAA      2940
     AETITRKMSK KDKKRAKKQA QEEIIEPTSP PTEDHAQSEK NEAVISLGTL DTPSPVEPTD      3000
     QNTNNEPLDL ERPAEKNDKK DEALVVADSQ NLENAAVDQP VQPEVMPAMS KKMSKKDKRK      3060
     VKKNAGITEE VLAQQQEPQA DVAELPTESE VQPAEPAAEK EIHQEPEHSA EAQPSLEREL      3120
     PIETPASIEN EPIPDPGVQV KPTQPDEEPV VSEEVPLSRK ASKKKAKKAQ KANKSLDAEA      3180
     LAENTIADHH TTIVPFEEDQ SKAEGLEVPD EKSAQDEEDW PAIDWQAKFE ESQRSREADP      3240
     EPEPDIPAPE PEIIGEFVDS SFREVSQDAN EATEEDAWAL PTSKKDKKKA KKNKKQSQQT      3300
     PPEAEGPSLE PFNDIEIEPP ARTTTPGGSK IANLFPGLER GGFRRSALDQ QPRSLKDSAE      3360
     EETTADLEAN RDVAIPVLEA PPATTETKEI PRDFTSELPS SLERQIESTI SELKAHSETP      3420
     TATEHGSIRE PELPPEGDKS KDMPSSLSME PSDERTRPTE PSSPTRLPPR EEAGKELCEL      3480
     RRSPSIHGRH QHTPRTWSLE EPSLPALRAP SPPRSLFGGP TDDYVRPRTP LDTIAEQEPR      3540
     DGQGATMARR GTPRLEMKPE HVLPRPQTPV RKFTDNAFDR EAWPKENKKG EGFKPEILKT      3600
     PEQGMPILKP STSSGKLRRT NRSISGDLRA ASRALDSQPS NLDLDQLPSS SSYDPVTDKG      3660
     KRPLRNMSDV YVSH                                                        3674
//

If you have problems or comments...

PBIL Back to PBIL home page