(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE48

PENCW_10.PE48        Location/Qualifiers
FT   CDS             join(complement(113839..114623),complement(113532..113784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977823"
FT                   /orf_name="Pc13g00480"
FT                   /product="Putative uncharacterized protein Pc13g00480 "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91117.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001830E96"
FT                   /db_xref="UniProtKB/TrEMBL:B6H186"
FT                   /transl_table=1
FT                   /translation="MSDPQWLWDPLSICEMGPIRETKTCCGITKKGDACKLIVKKDTLK
FT                   EGRHKLNNLARGPFNLSTLDSQLSDLVSFFLCKQWHRERQHNDVKQRWFDAAVRNQADV
FT                   QESPRQRFPHIIAEEIDGPQQEPASTALETDGFAPIWGVDAAFPRLPSPTWLEVTRPPG
FT                   RDVTPGMLTMNRVPWNVSRDNPAILSIHNEYGGLHSLQIHTVRQESCPDGERCPICFEG
FT                   DSDDLVMLQCGICKGVVHLGCMEGWLAHRLPGNNTSCPIHRCNGSFRALLRSSAVGNAT
FT                   GNSTAETPLEDTYTPVEETSVPTAPPQRRSTQTTRRSDRPRVFSSSSIIRRSPRSRRVP
FT                   DRFLP"
     MSDPQWLWDP LSICEMGPIR ETKTCCGITK KGDACKLIVK KDTLKEGRHK LNNLARGPFN        60
     LSTLDSQLSD LVSFFLCKQW HRERQHNDVK QRWFDAAVRN QADVQESPRQ RFPHIIAEEI       120
     DGPQQEPAST ALETDGFAPI WGVDAAFPRL PSPTWLEVTR PPGRDVTPGM LTMNRVPWNV       180
     SRDNPAILSI HNEYGGLHSL QIHTVRQESC PDGERCPICF EGDSDDLVML QCGICKGVVH       240
     LGCMEGWLAH RLPGNNTSCP IHRCNGSFRA LLRSSAVGNA TGNSTAETPL EDTYTPVEET       300
     SVPTAPPQRR STQTTRRSDR PRVFSSSSII RRSPRSRRVP DRFLP                       345
//

If you have problems or comments...

PBIL Back to PBIL home page