(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE480

PENCW_10.PE480       Location/Qualifiers
FT   CDS             join(complement(1159296..1163983),
FT                   complement(1158083..1158734))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951949"
FT                   /orf_name="Pc13g04800"
FT                   /product="Pc13g04800 protein"
FT                   /protein_id="CAP91549.1"
FT                   /db_xref="UniParc:UPI0001830DDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C9"
FT                   /transl_table=1
FT                   /translation="MFKALMGGGRSSSSDVRSSKSSRRKSEKHDKSDTRSISSRKFSRG
FT                   DDRDRGLGDLSSYPPSTSRSKRGPPSIAGESIASTYVTAEPEAIDESDRYYIERTPKRR
FT                   DSERESKSSRRHDQDRSESPEREKRRSRRGTQDTLDDDLDRESDRRERRRTHSGDPYVP
FT                   PISTNMPPSAPGAQFAAEIGAPGFSQFPMQYDAGMPPAGHSPAHEVPYDPHVQQQFPGQ
FT                   FPEQVAAPYPPPNPAGAAADYYGDQGQSVEHQPGIRPARPSVLPNTQAHLMAASPSANP
FT                   PPEPSSLGETGAAAAYFDDNFHAPAPQDQPPEVRPPKPSKPSKPSSSGVLPAAAVGAAA
FT                   HGIGGMVSHSESHSPPQHTTSYTQQGQPTVHDQPMVHHEPMEYDQPMASSSHKPPSKPP
FT                   HSHSFSEGVGIAAAGAATGYMMGHHHHSSSPEHAPQYAFEHHGQSSQVGGMLPYAPVHN
FT                   NALYAAGAGGYAAHAAHNPGFYPHGPSALAFQERQRGAMERFVDFWRDPEAVGRFEDYT
FT                   ETIGVCKYCFQPGTSSADAPRKHHYYRRRRHSPDRRSSGSSRVSKTSRYNSSDDEGRRR
FT                   SKSKKSSSWLPGVLAGYTAKSLFSSKAFDDSYSLRSGRVASHHGEEDDRRSRTSRGVAR
FT                   RSSRSPHRDYHTGSTHASQSGYSRHSRSRSRSSSRSGRPSCLKEAALGAAVGGAALAVA
FT                   KSRNPSRSRSPERRQYRKDSSSSSSFVNLPRPGKKSIAGGIGSFFTASSENKKKRHTKK
FT                   RSGFFSFKSGSSSSSLDNDLAFGDGFSRKPSKLKKKGKKGKDVDTALLELSDTATRLAG
FT                   SSPHGPGRSAGQMYKARSRQSNYSTTNDEWVDAESEDQSSSSVSSALAFGGSSVDSSSD
FT                   SASSKWGWRWGSKKDKKKKDKRSSATNAALVAGAGAIGAAAISSARDHDNNPPSRSGSL
FT                   QHVYPMPTSDPSRFDVAKMSPSVSAGEPTLIRPGPIPLQQPQPFTPVSQSVYTTQGAVP
FT                   GSIPVYSAPAVPPLFANGVEHFESQFQGPRGAAWAPESTYAERRKAPRRSDSSPVFPTQ
FT                   ETASSLKRRYTSKDQASVQFDLTEEQAERERHLTRRDKNYRGEFSDQPVQLIDREEELA
FT                   RHETERREHRRKERDDEEHRYAGDRGKHSSSWVGVAAAGAVGTAAASTILSRKTDDDEA
FT                   SEASQRYNERREKRRAERKRTEAVAVTSVVSRFEPTQPIDEEVTTAEHHEDQKKGSPRS
FT                   PRPPQVYDDYAEFYAPEELRHSPDDHARSRRSTDMPTIVEVEPASERRTHEEPAPTEVD
FT                   YSYEPYQHVDRLPWPVPALNFIEPTPPQSVNGGSVRDATSPTAPVNKSYDTKPRERPTG
FT                   SRVSWGEHETHEYEIPSSSEQDPFEHDISPAEISAKDVPLPASEITQSKDIPSTSQYGA
FT                   DIEFAATIAAATAAAGFDPSLITDDPSYHTRTSPPGSEGEHTFTSPWSASARNEPRGFV
FT                   EGELEEIDPKSTKDITSAPEHVSQDKDELFFDEPESFSRDRDISSGRRDKSSIAHEVIE
FT                   QLNGKYGKRDRTASPEKDVDVFSMPGGFDTAEPRDLADARSVAGYDFDPRLDAEAAPDD
FT                   VEGGEEKKRRRKRRSKHESDTFSVDDDARSAITDIGDEKSERRKHRHRSSRETDVDDNA
FT                   SITSSPARIDESREKRRGKDEKEKSGGFLRGIFGSQVSAPAERVRSDHSRSSSLDKRSS
FT                   REAISEIGVDDERRRHKRRSSKHRSSSNGDELDRYMSDKEKGTQDDTNLEEYRSSRQQK
FT                   EERRRHRYEEIVDSGRNRESEKV"
     MFKALMGGGR SSSSDVRSSK SSRRKSEKHD KSDTRSISSR KFSRGDDRDR GLGDLSSYPP        60
     STSRSKRGPP SIAGESIAST YVTAEPEAID ESDRYYIERT PKRRDSERES KSSRRHDQDR       120
     SESPEREKRR SRRGTQDTLD DDLDRESDRR ERRRTHSGDP YVPPISTNMP PSAPGAQFAA       180
     EIGAPGFSQF PMQYDAGMPP AGHSPAHEVP YDPHVQQQFP GQFPEQVAAP YPPPNPAGAA       240
     ADYYGDQGQS VEHQPGIRPA RPSVLPNTQA HLMAASPSAN PPPEPSSLGE TGAAAAYFDD       300
     NFHAPAPQDQ PPEVRPPKPS KPSKPSSSGV LPAAAVGAAA HGIGGMVSHS ESHSPPQHTT       360
     SYTQQGQPTV HDQPMVHHEP MEYDQPMASS SHKPPSKPPH SHSFSEGVGI AAAGAATGYM       420
     MGHHHHSSSP EHAPQYAFEH HGQSSQVGGM LPYAPVHNNA LYAAGAGGYA AHAAHNPGFY       480
     PHGPSALAFQ ERQRGAMERF VDFWRDPEAV GRFEDYTETI GVCKYCFQPG TSSADAPRKH       540
     HYYRRRRHSP DRRSSGSSRV SKTSRYNSSD DEGRRRSKSK KSSSWLPGVL AGYTAKSLFS       600
     SKAFDDSYSL RSGRVASHHG EEDDRRSRTS RGVARRSSRS PHRDYHTGST HASQSGYSRH       660
     SRSRSRSSSR SGRPSCLKEA ALGAAVGGAA LAVAKSRNPS RSRSPERRQY RKDSSSSSSF       720
     VNLPRPGKKS IAGGIGSFFT ASSENKKKRH TKKRSGFFSF KSGSSSSSLD NDLAFGDGFS       780
     RKPSKLKKKG KKGKDVDTAL LELSDTATRL AGSSPHGPGR SAGQMYKARS RQSNYSTTND       840
     EWVDAESEDQ SSSSVSSALA FGGSSVDSSS DSASSKWGWR WGSKKDKKKK DKRSSATNAA       900
     LVAGAGAIGA AAISSARDHD NNPPSRSGSL QHVYPMPTSD PSRFDVAKMS PSVSAGEPTL       960
     IRPGPIPLQQ PQPFTPVSQS VYTTQGAVPG SIPVYSAPAV PPLFANGVEH FESQFQGPRG      1020
     AAWAPESTYA ERRKAPRRSD SSPVFPTQET ASSLKRRYTS KDQASVQFDL TEEQAERERH      1080
     LTRRDKNYRG EFSDQPVQLI DREEELARHE TERREHRRKE RDDEEHRYAG DRGKHSSSWV      1140
     GVAAAGAVGT AAASTILSRK TDDDEASEAS QRYNERREKR RAERKRTEAV AVTSVVSRFE      1200
     PTQPIDEEVT TAEHHEDQKK GSPRSPRPPQ VYDDYAEFYA PEELRHSPDD HARSRRSTDM      1260
     PTIVEVEPAS ERRTHEEPAP TEVDYSYEPY QHVDRLPWPV PALNFIEPTP PQSVNGGSVR      1320
     DATSPTAPVN KSYDTKPRER PTGSRVSWGE HETHEYEIPS SSEQDPFEHD ISPAEISAKD      1380
     VPLPASEITQ SKDIPSTSQY GADIEFAATI AAATAAAGFD PSLITDDPSY HTRTSPPGSE      1440
     GEHTFTSPWS ASARNEPRGF VEGELEEIDP KSTKDITSAP EHVSQDKDEL FFDEPESFSR      1500
     DRDISSGRRD KSSIAHEVIE QLNGKYGKRD RTASPEKDVD VFSMPGGFDT AEPRDLADAR      1560
     SVAGYDFDPR LDAEAAPDDV EGGEEKKRRR KRRSKHESDT FSVDDDARSA ITDIGDEKSE      1620
     RRKHRHRSSR ETDVDDNASI TSSPARIDES REKRRGKDEK EKSGGFLRGI FGSQVSAPAE      1680
     RVRSDHSRSS SLDKRSSREA ISEIGVDDER RRHKRRSSKH RSSSNGDELD RYMSDKEKGT      1740
     QDDTNLEEYR SSRQQKEERR RHRYEEIVDS GRNRESEKV                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page