(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE481

PENCW_10.PE481       Location/Qualifiers
FT   CDS             join(complement(1165818..1165854),
FT                   complement(1164752..1165761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672738"
FT                   /orf_name="Pc13g04810"
FT                   /product="Pc13g04810 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91550.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001830DDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D0"
FT                   /transl_table=1
FT                   /translation="MTPNARKWPSREGFTADVLGKFISRSLLDPWKLVPIVALAQYTAQ
FT                   GRDIAKARPNLEKALKALTALALINRLGNWLDRRTLNNSTSDPYDWNREVVILTGGSNG
FT                   IGRRIAELLGARDIKVAILDIAPPATDDVLPNSVRCYECDITSATDIADVASKIRSSFG
FT                   RPSILINNAGICTGKTILKTTPAQTRRMFEVNTLAHYWLAQEFLPDMIEANHGMVVTVA
FT                   SLAGYTVTPNMVDYSATKAAAIAFHEGLAAELVTRYHAPKVRTVLVTQGFTRTNLIKDL
FT                   TPEDTWLNPLLHPETVAEELVRQVLKAESGHVVIPGSAGWIARRFRGQPEWLQHLLRCR
FT                   LEKLMRAD"
     MTPNARKWPS REGFTADVLG KFISRSLLDP WKLVPIVALA QYTAQGRDIA KARPNLEKAL        60
     KALTALALIN RLGNWLDRRT LNNSTSDPYD WNREVVILTG GSNGIGRRIA ELLGARDIKV       120
     AILDIAPPAT DDVLPNSVRC YECDITSATD IADVASKIRS SFGRPSILIN NAGICTGKTI       180
     LKTTPAQTRR MFEVNTLAHY WLAQEFLPDM IEANHGMVVT VASLAGYTVT PNMVDYSATK       240
     AAAIAFHEGL AAELVTRYHA PKVRTVLVTQ GFTRTNLIKD LTPEDTWLNP LLHPETVAEE       300
     LVRQVLKAES GHVVIPGSAG WIARRFRGQP EWLQHLLRCR LEKLMRAD                    348
//

If you have problems or comments...

PBIL Back to PBIL home page