(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE482

PENCW_10.PE482       Location/Qualifiers
FT   CDS             join(complement(1167392..1169445),
FT                   complement(1167006..1167321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951950"
FT                   /orf_name="Pc13g04820"
FT                   /product="Pc13g04820 protein"
FT                   /protein_id="CAP91551.1"
FT                   /db_xref="UniParc:UPI0001830DDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D1"
FT                   /transl_table=1
FT                   /translation="MPRTQVSPNVFDPGSQDLGASKFGQKLPPMDPRLDQKEAEGELSI
FT                   PVEHTTAAHKLLMWPSIKRLLHPAHYDEDYVMRLEEERGLISIYGQGEISYTADDSQLP
FT                   MDGDSRGARPDVNGAGPDANVDIDEFGNLNLDAATARRYYDSYLEHMFKLHPFLMEGEL
FT                   NIKVDSFIRSYCRLNNSPPSSSSGYSRPARDGPPPAKRRRSNENLGVRGEYMETIPNPL
FT                   RPRVGKNIDNALVLLCLALGAICEAPTPLPGPIMDKKIDYLNQPIPAPLPPLTPPQPAN
FT                   TTYVTNANGVLSPANSDSAAMQMSFSNSLYSVPTQPAGQAFPNSPFTKGIEGLSRRDVT
FT                   NTRDEQGNTKNYQVIPGLTLYGYATTILGHLQGGNELEHVQCGLLAGLYAGQLAHPFQS
FT                   HSWISQASRACQVLVRTKRYERLEEGATQDLYNFAYWTCLQLESDLLAELDIPASGISR
FT                   SEGRMAIPKGKWTIVLPNDLTAPETMMMLFYSAQIHLRKLLNRVHTDLYKVEKQGQTRW
FT                   SSTVQEALSLNLDLWRNSLPHSMQWSENDPPADEINAARMRAKYYGARYIIHRPLLYHA
FT                   LHYGYTGARVGPIGKSLVDSPTSQQLSPSMMHSAGRAPSMARMSSEMGSMPAALSTDWQ
FT                   PPKVRLHELPKKLKTACDICIRSAIKSTEAFDGVGGHRLVVTNIFGTAHAQFGNMLVLS
FT                   ATYMSSLKELVDQDQLDRLLVRTIGFLIQSENISPTLRADARILTEIYKKIFGRAPDLR
FT                   RATKVSSQTPSMNSQTPSLSSQTPSLSSHTTSMSFP"
     MPRTQVSPNV FDPGSQDLGA SKFGQKLPPM DPRLDQKEAE GELSIPVEHT TAAHKLLMWP        60
     SIKRLLHPAH YDEDYVMRLE EERGLISIYG QGEISYTADD SQLPMDGDSR GARPDVNGAG       120
     PDANVDIDEF GNLNLDAATA RRYYDSYLEH MFKLHPFLME GELNIKVDSF IRSYCRLNNS       180
     PPSSSSGYSR PARDGPPPAK RRRSNENLGV RGEYMETIPN PLRPRVGKNI DNALVLLCLA       240
     LGAICEAPTP LPGPIMDKKI DYLNQPIPAP LPPLTPPQPA NTTYVTNANG VLSPANSDSA       300
     AMQMSFSNSL YSVPTQPAGQ AFPNSPFTKG IEGLSRRDVT NTRDEQGNTK NYQVIPGLTL       360
     YGYATTILGH LQGGNELEHV QCGLLAGLYA GQLAHPFQSH SWISQASRAC QVLVRTKRYE       420
     RLEEGATQDL YNFAYWTCLQ LESDLLAELD IPASGISRSE GRMAIPKGKW TIVLPNDLTA       480
     PETMMMLFYS AQIHLRKLLN RVHTDLYKVE KQGQTRWSST VQEALSLNLD LWRNSLPHSM       540
     QWSENDPPAD EINAARMRAK YYGARYIIHR PLLYHALHYG YTGARVGPIG KSLVDSPTSQ       600
     QLSPSMMHSA GRAPSMARMS SEMGSMPAAL STDWQPPKVR LHELPKKLKT ACDICIRSAI       660
     KSTEAFDGVG GHRLVVTNIF GTAHAQFGNM LVLSATYMSS LKELVDQDQL DRLLVRTIGF       720
     LIQSENISPT LRADARILTE IYKKIFGRAP DLRRATKVSS QTPSMNSQTP SLSSQTPSLS       780
     SHTTSMSFP                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page