(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE483

PENCW_10.PE483       Location/Qualifiers
FT   CDS             complement(1169856..1170416)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825425"
FT                   /orf_name="Pc13g04830"
FT                   /product="Pc13g04830 protein"
FT                   /protein_id="CAP91552.1"
FT                   /db_xref="UniParc:UPI0001830DDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D2"
FT                   /transl_table=1
FT                   /translation="MNRMPPPEAHHTHAGPHTAYDPSWRPPYPPAFDNHPSDSRRSSAN
FT                   SQTALPPQPPGYPVMPNRELPQLTPEGPYGRPNGHGLPLHAPVHSPQDPIPTHPNFHQP
FT                   MNGAPHEGSPDYRARMGYPPPDQISSAEHTPVSGALPPASQFMTPVAQMANVTPPAGYD
FT                   QAFYQNQTFGARQRKANRATQVC"
     MNRMPPPEAH HTHAGPHTAY DPSWRPPYPP AFDNHPSDSR RSSANSQTAL PPQPPGYPVM        60
     PNRELPQLTP EGPYGRPNGH GLPLHAPVHS PQDPIPTHPN FHQPMNGAPH EGSPDYRARM       120
     GYPPPDQISS AEHTPVSGAL PPASQFMTPV AQMANVTPPA GYDQAFYQNQ TFGARQRKAN       180
     RATQVC                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page