(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE485

PENCW_10.PE485       Location/Qualifiers
FT   CDS             join(complement(1178233..1178300),
FT                   complement(1177997..1178161),complement(1177664..1177776),
FT                   complement(1177418..1177527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978594"
FT                   /orf_name="Pc13g04850"
FT                   /product="Putative uncharacterized protein Pc13g04850 "
FT                   /protein_id="CAP91554.1"
FT                   /db_xref="UniParc:UPI0001830EAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B9"
FT                   /transl_table=1
FT                   /translation="MEGDTYLGKYVPGAFSAVYNISGQTEYFQCTTLYGVSRGDGEKDH
FT                   DCAWSFERKSWSFHPALVYSVSPSFPIPPKRDVEYTMRPCFPKTALVSKYTNVSYAESV
FT                   TAPTFPSRNFPGLGLGVVRSELVGCFGKRKISTYQQKKQEYAEGFIY"
     MEGDTYLGKY VPGAFSAVYN ISGQTEYFQC TTLYGVSRGD GEKDHDCAWS FERKSWSFHP        60
     ALVYSVSPSF PIPPKRDVEY TMRPCFPKTA LVSKYTNVSY AESVTAPTFP SRNFPGLGLG       120
     VVRSELVGCF GKRKISTYQQ KKQEYAEGFI Y                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page